DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vap and Rasal2

DIOPT Version :9

Sequence 1:NP_001285314.1 Gene:vap / 32569 FlyBaseID:FBgn0003969 Length:954 Species:Drosophila melanogaster
Sequence 2:XP_006496813.1 Gene:Rasal2 / 226525 MGIID:2443881 Length:1289 Species:Mus musculus


Alignment Length:587 Identity:146/587 - (24%)
Similarity:256/587 - (43%) Gaps:113/587 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   365 TLRECRDQI-GLKKIKGIKHHGHLNKKSDKTTKWKQLYFALINDGSETQLCF---YDNPKKTKPK 425
            :||...|:. ||.|:|..:.|.                 :|::..|..: |.   ...|...|| 
Mouse   217 SLRNADDRSRGLPKLKESRSHE-----------------SLLSPCSAVE-CLDLGRGEPVSVKP- 262

  Fly   426 GLIDLSCAYLYQCHDSLWERPYCFQIVERALPCLATVTYL-------CAPSQESYVEWINSLKAQ 483
                        .|.|:..:.:||:           ||||       |:.:.|. .:|:.:|:..
Mouse   263 ------------LHSSILGQDFCFE-----------VTYLSGSKCFSCSSASER-DKWMENLRRT 303

  Fly   484 CDSQLSRAQKKVSRLRELRCLNLHVLEAHRL-PFKLVPHPYCSISLNQVKVGKTRVKIAPEPV-W 546
            ........::..:.||      |.::||..| |.|..   :|.:.|:.....:|..|...:.: |
Mouse   304 VQPNKDNCRRAENVLR------LWIIEAKDLAPKKKY---FCELCLDDTLFARTTSKTKADNIFW 359

  Fly   547 EEEFVLDDVPPDVVSLTITLI----SRGKRGKDSEVAELTIDLSSLKNGQETEGWYQLTGMTP-M 606
            .|.|....:|| :.|:|:.:.    .:.|:.|::.|..:.|..:|:...|..|.||.::..|| .
Mouse   360 GEHFEFYSLPP-LHSITVHIYKDVEKKKKKDKNNYVGLVNIPTASVTGRQFVEKWYPVSTPTPNK 423

  Fly   607 GEWG--SLRLRMRYLDDLIMPCEEYSPLQQLLLESELYAVKALAELCH-NDRVPLATALLRVFRQ 668
            |:.|  |:|::.|:....|:|.|:|....:.:..:.......|..:.. .::..||.||:.:.:.
Mouse   424 GKTGGPSIRIKSRFQTITILPMEQYKEFAEFITSNYTMLCSVLEPVISVRNKEELACALVHILQS 488

  Fly   669 EKRETELIRMLCQAEVTRENETTTL-FRGASLATTLMDLYMRTECSGFLQSAVSETVQRILESKQ 732
            ..|..:.:..|..:||.|..|...| ||..::||..::.|::.....:|..|:.|.::.:.||.:
Mouse   489 TGRAKDFLTDLVMSEVDRCGEHDVLIFRENTIATKSIEEYLKLVGQQYLHDALGEFIKALYESDE 553

  Fly   733 SAELNPTKMDVNDDACTNAEF------LLQILDLVTQSIFTSPDACPRNVRFICSCLQKAVMAKW 791
            :.|::|:|       |:::|.      |....:|....|..|....||.:        |.|.|.|
Mouse   554 NCEVDPSK-------CSSSELMDHQSNLKMCCELAFCKIINSYCVFPREL--------KEVFASW 603

  Fly   792 PTERL------VRTRVVSGFIFLRLLCPALLNPRQFGLVSETPPMAATRSLVMVAKCLQNLANLI 850
            ..:.|      :..|::|..:|||.||||:::|..|.|:.|.|....:|:|.::||.:|||||..
Mouse   604 KQQCLNRGKQDISERLISASLFLRFLCPAIMSPSLFNLMQEYPDDRTSRTLTLIAKVIQNLANFA 668

  Fly   851 EFGGKEQYMEVVNPFILKNKERMIVFLDQLSSVNDPNQPLGM--FVEQSTNLNSQDTGRELATLH 913
            :||.||:||..:|.|:......|..||.::|:.:..:...|.  ::         |.||||:.||
Mouse   669 KFGNKEEYMAFMNDFLEHEWGGMKRFLLEISNPDTISNTPGFDGYI---------DLGRELSVLH 724

  Fly   914 HI 915
            .:
Mouse   725 SL 726

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vapNP_001285314.1 SH2_Nterm_RasGAP 64..166 CDD:198216
SH3_RasGAP 183..241 CDD:212722
SH2_Cterm_RasGAP 252..326 CDD:198217
PH_RASA1 379..484 CDD:270080 20/114 (18%)
C2_Ras_p21A1 499..622 CDD:176045 34/131 (26%)
RasGAP 620..954 CDD:413381 85/312 (27%)
Rasal2XP_006496813.1 PH-like 181..364 CDD:388408 40/198 (20%)
C2_SynGAP_like 306..445 CDD:175980 36/148 (24%)
RasGAP_DAB2IP 436..766 CDD:213338 86/315 (27%)
DUF3498 756..1232 CDD:371844
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3508
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.