DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8939 and rlmE

DIOPT Version :10

Sequence 1:NP_573099.1 Gene:CG8939 / 32568 FlyBaseID:FBgn0030720 Length:817 Species:Drosophila melanogaster
Sequence 2:NP_417646.1 Gene:rlmE / 947689 ECOCYCID:EG11507 Length:209 Species:Escherichia coli


Alignment Length:204 Identity:69/204 - (33%)
Similarity:101/204 - (49%) Gaps:6/204 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GKKTKVGKTR------KDKFYQLAKETGLRSRAAFKLIQLNRKFGFLQQSQVCLDLCAAPGGWMQ 60
            |||.....:|      .||:.|.|::.||||||.|||.::.:.....:.....:||.||||||.|
E. coli     3 GKKRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQQSDKLFKPGMTVVDLGAAPGGWSQ 67

  Fly    61 VAKQNMPVSSIVIGVDLFPIRPIAGCIGLVEDITTEKCRQSLTKELQSWKADVVLHDGAPNVGRN 125
            .....:.....:|..||.|:.||.|...|..|...|...::|.:.:...|..||:.|.|||:...
E. coli    68 YVVTQIGGKGRIIACDLLPMDPIVGVDFLQGDFRDELVMKALLERVGDSKVQVVMSDMAPNMSGT 132

  Fly   126 WLYDAYQQICLTLNALKLSTQFLRNGGWFVTKVFRSKDYNALLWVLKQLFKKVHATKPSASRKES 190
            ...|..:.:.|...||::....|..||.||.|||:.:.::..|..::.||.||...||.:||..|
E. coli   133 PAVDIPRAMYLVELALEMCRDVLAPGGSFVVKVFQGEGFDEYLREIRSLFTKVKVRKPDSSRARS 197

  Fly   191 AEIFVVCQG 199
            .|:::|..|
E. coli   198 REVYIVATG 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8939NP_573099.1 RlmE 1..200 CDD:440062 69/204 (34%)
DUF3381 233..366 CDD:463375
Spb1_C 610..803 CDD:462264
rlmENP_417646.1 rrmJ 1..208 CDD:183025 69/204 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.