DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8939 and MRM2

DIOPT Version :9

Sequence 1:NP_573099.1 Gene:CG8939 / 32568 FlyBaseID:FBgn0030720 Length:817 Species:Drosophila melanogaster
Sequence 2:NP_011379.1 Gene:MRM2 / 852741 SGDID:S000003104 Length:320 Species:Saccharomyces cerevisiae


Alignment Length:267 Identity:74/267 - (27%)
Similarity:105/267 - (39%) Gaps:82/267 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KDKFYQLAKETGLRSRAAFKLIQLNRKFGFLQQS---QVCLDLCAAPGGWMQVAKQNMPVSSIVI 73
            ||.:.:.||...|||||||||:|::.|:....::   |..|||..|||.|.|||:|....:|:::
Yeast    37 KDPYTKEAKVQNLRSRAAFKLMQIDDKYRLFSKNRTDQRILDLGYAPGAWSQVARQRSSPNSMIL 101

  Fly    74 GVDLFPIRPIAGCIG----------------------------------------LVEDIT---- 94
            |||:.|..|..|...                                        |.|::|    
Yeast   102 GVDILPCEPPHGVNSIQANILAKRTHDLIRLFFSKHFQLNRHDDLHKDHGYFQNMLEEELTHVKD 166

  Fly    95 TEKCRQSLTK--------------ELQSWKADVVLHD---------GAPNVGRNWLY-------- 128
            ||..|:..|.              |.:.:..||::.|         |..|...|..|        
Yeast   167 TELYREIFTSDDIYETPNTNSTLIEREKFPVDVIISDMYEPWPQTTGFWNNITNQAYFRMANTSG 231

  Fly   129 ----DAYQQICLTLNALKLSTQFLRNGGWFVTKVFRSKDYNALLWVLKQLFKKVHATKPSASRKE 189
                |.||.|.|...||..:...||..|.||.|::..::.|.....::.:|..||..||.|||.|
Yeast   232 VSIRDHYQSIDLCDAALVTAIDLLRPLGSFVCKLYTGEEENLFKKRMQAVFTNVHKFKPDASRDE 296

  Fly   190 SAEIFVV 196
            |.|.:.:
Yeast   297 SKETYYI 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8939NP_573099.1 RlmE 8..203 CDD:223370 74/267 (28%)
DUF3381 233..366 CDD:288694
Spb1_C 611..803 CDD:285075
MRM2NP_011379.1 RlmE 25..310 CDD:223370 74/267 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0293
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.