Sequence 1: | NP_573099.1 | Gene: | CG8939 / 32568 | FlyBaseID: | FBgn0030720 | Length: | 817 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_011379.1 | Gene: | MRM2 / 852741 | SGDID: | S000003104 | Length: | 320 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 267 | Identity: | 74/267 - (27%) |
---|---|---|---|
Similarity: | 105/267 - (39%) | Gaps: | 82/267 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 KDKFYQLAKETGLRSRAAFKLIQLNRKFGFLQQS---QVCLDLCAAPGGWMQVAKQNMPVSSIVI 73
Fly 74 GVDLFPIRPIAGCIG----------------------------------------LVEDIT---- 94
Fly 95 TEKCRQSLTK--------------ELQSWKADVVLHD---------GAPNVGRNWLY-------- 128
Fly 129 ----DAYQQICLTLNALKLSTQFLRNGGWFVTKVFRSKDYNALLWVLKQLFKKVHATKPSASRKE 189
Fly 190 SAEIFVV 196 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8939 | NP_573099.1 | RlmE | 8..203 | CDD:223370 | 74/267 (28%) |
DUF3381 | 233..366 | CDD:288694 | |||
Spb1_C | 611..803 | CDD:285075 | |||
MRM2 | NP_011379.1 | RlmE | 25..310 | CDD:223370 | 74/267 (28%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0293 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |