DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8939 and AT5G01230

DIOPT Version :9

Sequence 1:NP_573099.1 Gene:CG8939 / 32568 FlyBaseID:FBgn0030720 Length:817 Species:Drosophila melanogaster
Sequence 2:NP_851026.1 Gene:AT5G01230 / 830268 AraportID:AT5G01230 Length:309 Species:Arabidopsis thaliana


Alignment Length:237 Identity:84/237 - (35%)
Similarity:126/237 - (53%) Gaps:21/237 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KVGKTRKDKFYQLAKETGLRSRAAFKLIQLNRKFGFLQQSQVCLDLCAAPGGWMQVAKQN--MPV 68
            |..:.::|.:|:.|||.|.|:|:||||:|::.:|...:..:..:|||||||.|.||..:.  :|.
plant     3 KASRDKRDIYYRKAKEEGWRARSAFKLLQIDEEFNIFEGVKRVVDLCAAPGSWSQVLSRQLYLPA 67

  Fly    69 SS----------IVIGVDLFPIRPIAGCIGLVEDITTEKCRQSLTKELQSWKADVVLHDGAPNVG 123
            .|          :::.:||.|:.||.|.|.:..|||..:..:.:.:.....|||:|:.||||:|.
plant    68 KSSAESKDGDLPLIVAIDLQPMAPIEGVIQVQGDITNARTAEVVIRHFDGCKADLVVCDGAPDVT 132

  Fly   124 RNWLYDAYQQICLTLNALKLSTQFLRNGGWFVTKVFRSKDYNALLWVLKQLFKKVHATKPSASRK 188
            .....|.:.|..|.|..|.:.|..|:.||.|:.|:||.||.:.|...||..|..|...||.:||.
plant   133 GLHDMDEFVQSQLILAGLTIVTHILKEGGKFIAKIFRGKDTSLLYCQLKLFFPTVTFAKPKSSRN 197

  Fly   189 ESAEIFVVCQGYLAPDHIDPRLLDSKYVFEEL-------DLD 223
            .|.|.|.||:.|..|:..:||  |...:.|::       |||
plant   198 SSIEAFAVCENYSPPEGFNPR--DLHRLLEKVGSPSGGSDLD 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8939NP_573099.1 RlmE 8..203 CDD:223370 75/206 (36%)
DUF3381 233..366 CDD:288694
Spb1_C 611..803 CDD:285075
AT5G01230NP_851026.1 RlmE 5..213 CDD:223370 75/207 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0293
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1362679at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.