DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8939 and Trm7-34

DIOPT Version :10

Sequence 1:NP_573099.1 Gene:CG8939 / 32568 FlyBaseID:FBgn0030720 Length:817 Species:Drosophila melanogaster
Sequence 2:NP_650947.1 Gene:Trm7-34 / 42508 FlyBaseID:FBgn0038861 Length:320 Species:Drosophila melanogaster


Alignment Length:234 Identity:90/234 - (38%)
Similarity:129/234 - (55%) Gaps:11/234 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VGKTRKDK---FYQLAKETGLRSRAAFKLIQLNRKFGFLQQSQVCLDLCAAPGGWMQVAKQNM-- 66
            :|:|.|||   ||:||||.|.|:|:||||:|.:..|..|:.....:|||||||.|.||..:.:  
  Fly     1 MGRTSKDKRDIFYRLAKEQGWRARSAFKLLQADETFQLLEGLTRAVDLCAAPGSWSQVLAKRLYE 65

  Fly    67 PV------SSIVIGVDLFPIRPIAGCIGLVEDITTEKCRQSLTKELQSWKADVVLHDGAPNVGRN 125
            |:      ...:|.|||..:.||.|...|..||:.|...:::.:.....||.:|:.||||:....
  Fly    66 PLPPEEREKVKIIAVDLQGMAPIEGVKQLRADISKESTAEAIIEFFGGEKAQIVVSDGAPDSTGM 130

  Fly   126 WLYDAYQQICLTLNALKLSTQFLRNGGWFVTKVFRSKDYNALLWVLKQLFKKVHATKPSASRKES 190
            ..:|:|.|..|.|:||.:||..|..||.||:|::|:...:.|...||:.||.|...||||||..|
  Fly   131 HDFDSYVQGELLLSALSISTFILEEGGSFVSKIYRADRTSRLYTQLKRFFKNVCVFKPSASRNSS 195

  Fly   191 AEIFVVCQGYLAPDHIDPRLLDSKYVFEELDLDAKKKSS 229
            .|.|||.:.:..||...|..|.:::..:......:||.|
  Fly   196 IEAFVVAREFCLPDGYKPCNLTTEWHDQPESWVGRKKES 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8939NP_573099.1 RlmE 1..200 CDD:440062 83/203 (41%)
DUF3381 233..366 CDD:463375
Spb1_C 610..803 CDD:462264
Trm7-34NP_650947.1 RlmE 1..205 CDD:440062 83/203 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.