DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8939 and CG5220

DIOPT Version :9

Sequence 1:NP_573099.1 Gene:CG8939 / 32568 FlyBaseID:FBgn0030720 Length:817 Species:Drosophila melanogaster
Sequence 2:NP_650590.1 Gene:CG5220 / 42056 FlyBaseID:FBgn0038471 Length:302 Species:Drosophila melanogaster


Alignment Length:246 Identity:85/246 - (34%)
Similarity:132/246 - (53%) Gaps:19/246 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VGKTRKDK---FYQLAKETGLRSRAAFKLIQLNRKFGFLQQSQVCLDLCAAPGGWMQVAKQNM-- 66
            :|||.|||   :|:.||:.|.|:|:||||:.::..:|.|...|..:|||||||.|.||..:.:  
  Fly     1 MGKTSKDKRDIYYRQAKDEGWRARSAFKLLHVDEAYGILNGVQRAVDLCAAPGSWSQVLSRKLYD 65

  Fly    67 ------PVSSI-VIGVDLFPIRPIAGCIGLVEDITTEKCRQSLTKEL-QSWKADVVLHDGAPNVG 123
                  ..|:: :|.|||..:.||.|.:.|..|||.:...:::.... .:.||.:|:.||||:|.
  Fly    66 TCETDDEKSAVKIIAVDLQAMAPIRGILQLQGDITKQSTAEAIIGHFGGNEKAQLVVCDGAPDVT 130

  Fly   124 RNWLYDAYQQICLTLNALKLSTQFLRNGGWFVTKVFRSKDYNALLWVLKQLFKKVHATKPSASRK 188
            .....|.|.|..|.:.||.::|..|..||.||.|:|:....:.|...::..|||....||.:||.
  Fly   131 GVHEMDEYMQHQLLVAALSIATCVLETGGTFVAKIFKGNATSLLSSQMQIFFKKFDIYKPPSSRP 195

  Fly   189 ESAEIFVVCQGYLAPDHIDPRLLDSKYVFEELDLDAKKKSSLLHPEKQKRI 239
            .|.|.||||..:..|:...|::::.  ..:::.|.|:|..|    |..:|:
  Fly   196 SSIEAFVVCSDFCLPEGYIPQVINP--ARDDIRLLAQKTGS----EVNRRL 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8939NP_573099.1 RlmE 8..203 CDD:223370 77/207 (37%)
DUF3381 233..366 CDD:288694 2/7 (29%)
Spb1_C 611..803 CDD:285075
CG5220NP_650590.1 RlmE 3..211 CDD:223370 76/207 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440466
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0293
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1362679at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10920
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.