DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8939 and MRM2

DIOPT Version :10

Sequence 1:NP_573099.1 Gene:CG8939 / 32568 FlyBaseID:FBgn0030720 Length:817 Species:Drosophila melanogaster
Sequence 2:NP_037525.1 Gene:MRM2 / 29960 HGNCID:16352 Length:246 Species:Homo sapiens


Alignment Length:200 Identity:72/200 - (36%)
Similarity:104/200 - (52%) Gaps:13/200 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KDKFYQLAKETGLRSRAAFKLIQLNRKFGFLQQSQVCLDLCAAPGGWMQVAKQNM------PVSS 70
            :|.|.:.||....|.|:||||:::|.:...|:.....||..||||.|.|||.|.:      |.|.
Human    40 RDPFVKAAKVESYRCRSAFKLLEVNERHQILRPGLRVLDCGAAPGAWSQVAVQKVNAAGTDPSSP 104

  Fly    71 I--VIGVDLFPIRPIAGCIGLV-EDITTEKCRQSLTKELQSWKADVVLHDGAPNVG--RNWLYDA 130
            :  |:||||..|.|:.|...|. .|:|..:..|.:.:.|...:|||:|.|.|||..  |:..:|.
Human   105 VGFVLGVDLLHIFPLEGATFLCPADVTDPRTSQRILEVLPGRRADVILSDMAPNATGFRDLDHDR 169

  Fly   131 YQQICLTLNALKLSTQFLRNGGWFVTKVFRSKDYNALLWVLKQLFKKVHATKPSASRKESAEIFV 195
            ...:||||  |.::...|:.||.|:.|.:.......|...|.:.|:.|...||.||||||:|::.
Human   170 LISLCLTL--LSVTPDILQPGGTFLCKTWAGSQSRRLQRRLTEEFQNVRIIKPEASRKESSEVYF 232

  Fly   196 VCQGY 200
            :...|
Human   233 LATQY 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8939NP_573099.1 RlmE 1..200 CDD:440062 71/198 (36%)
DUF3381 233..366 CDD:463375
Spb1_C 610..803 CDD:462264
MRM2NP_037525.1 RlmE 25..239 CDD:440062 71/199 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.