DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8939 and FTSJ1

DIOPT Version :9

Sequence 1:NP_573099.1 Gene:CG8939 / 32568 FlyBaseID:FBgn0030720 Length:817 Species:Drosophila melanogaster
Sequence 2:NP_036412.1 Gene:FTSJ1 / 24140 HGNCID:13254 Length:329 Species:Homo sapiens


Alignment Length:372 Identity:119/372 - (31%)
Similarity:169/372 - (45%) Gaps:70/372 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VGKTRKDK---FYQLAKETGLRSRAAFKLIQLNRKFGFLQQSQVCLDLCAAPGGWMQVAKQNM-- 66
            :|:|.|||   :|:||||.|.|:|:||||:||:::|...|.....:|||||||.|.||..|.:  
Human     1 MGRTSKDKRDVYYRLAKENGWRARSAFKLLQLDKEFQLFQGVTRAVDLCAAPGSWSQVLSQKIGG 65

  Fly    67 PVSSIVIGVDLFPIRPIAGCIGLVEDITTEKCRQSLTKELQSWKADVVLHDGAPNVGRNWLYDAY 131
            ..|..|:.|||..:.|:.|.:.:..|||.....:.:.:..:...||:|:.||||:|......|.|
Human    66 QGSGHVVAVDLQAMAPLPGVVQIQGDITQLSTAKEIIQHFKGCPADLVVCDGAPDVTGLHDVDEY 130

  Fly   132 QQICLTLNALKLSTQFLRNGGWFVTKVFRSKDYNALLWVLKQLFKKVHATKPSASRKESAEIFVV 196
            .|..|.|.||.::|..|:.||.||.|:||.:|...|...|:..|..|...||.:||..|.|.|.|
Human   131 MQAQLLLAALNIATHVLKPGGCFVAKIFRGRDVTLLYSQLQVFFSSVLCAKPRSSRNSSIEAFAV 195

  Fly   197 CQGYLAPDHIDP----RLLDSKY--VFEELDLDAKKKSSLLHPEKQKRIKAEGYTAQDIALRNDL 255
            ||||..|:...|    .|||..|  .|.:||             ...||.....|..|       
Human   196 CQGYDPPEGFIPDLSKPLLDHSYDPDFNQLD-------------GPTRIIVPFVTCGD------- 240

  Fly   256 AATEFLKAENALAALQGIGSIRIDDQRIANHKKT-------TPEILECCKDLKVLGRKDIKGLVQ 313
                       |::.....|..:|.:..:.:|.|       :|...|.|    .|.||.     |
Human   241 -----------LSSYDSDRSYPLDLEGGSEYKYTPPTQPPISPPYQEAC----TLKRKG-----Q 285

  Fly   314 WWKDVRELFVEKETPLVVGNAADEKPKPLTQAEIE-----DMEDAEL 355
            ..|::|    .::.|:   :..|..|:||...:..     :|||.|:
Human   286 LAKEIR----PQDCPI---SRVDTFPQPLAAPQCHTLLAPEMEDNEM 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8939NP_573099.1 RlmE 8..203 CDD:223370 83/199 (42%)
DUF3381 233..366 CDD:288694 27/135 (20%)
Spb1_C 611..803 CDD:285075
FTSJ1NP_036412.1 RlmE 4..203 CDD:223370 82/198 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0293
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1362679at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.