DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8939 and R74.7

DIOPT Version :9

Sequence 1:NP_573099.1 Gene:CG8939 / 32568 FlyBaseID:FBgn0030720 Length:817 Species:Drosophila melanogaster
Sequence 2:NP_497843.1 Gene:R74.7 / 175543 WormBaseID:WBGene00011281 Length:337 Species:Caenorhabditis elegans


Alignment Length:387 Identity:113/387 - (29%)
Similarity:180/387 - (46%) Gaps:84/387 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VGKTRKDK---FYQLAKETGLRSRAAFKLIQLNRKFGFLQQSQVCLDLCAAPGGWMQVAKQNM-- 66
            :|||.:||   :|:||||...|:|:||||:|::.:|..|:..:..:|||||||.|.||..:.:  
 Worm     1 MGKTSRDKRDIYYRLAKENKWRARSAFKLMQIDDEFQILKGVRRAVDLCAAPGSWSQVLSKRLYE 65

  Fly    67 -PVSSIVIGVDLFPIRPIAGCIGLVEDITTEKCRQSLTKELQSWKADVVLHDGAPNVGRNWLYDA 130
             ...:.::.:||.|:.||.|.|.|..|||:......:.|.....|:|:|:.||||:|......|.
 Worm    66 EDQEAKIVAIDLQPMAPIPGVIQLQGDITSVDTANQVIKHFSGEKSDIVICDGAPDVTGIHSLDE 130

  Fly   131 YQQICLTLNALKLSTQFLRNGGWFVTKVFRSKDYNALLWVLKQLFKKVHATKPSASRKESAEIFV 195
            :.|..|.|.|..:::..|:.||.|:.|:|||::.:.|...:|:.||||:..||.:||:.|.|.||
 Worm   131 FMQAELILAAFNITSHVLKEGGNFLAKIFRSRNSSLLYAQMKKYFKKVYLAKPRSSRQSSCEAFV 195

  Fly   196 VCQGYLAPD-----------------HIDPRLLD--------SKYVFEE---LDLDAKKKSSLLH 232
            :|..|..|:                 .|.|.::|        |.:..|:   ||:||......:.
 Worm   196 LCLDYSPPEGFVPTMGKTSLDATDASAISPDIIDGFVTCGDLSGWDSEKSYPLDIDACFPKGEID 260

  Fly   233 PEKQKRIKAEGYTAQDIALRNDLAATEFLKAENALAALQGIGSIRIDDQRIANHKKTTPEILECC 297
            .|::||     |..:|:.......|.:        |||.               ||.:....:..
 Worm   261 EEQKKR-----YEFKDVVQPPTDPAYK--------AALD---------------KKKSGVFAKMS 297

  Fly   298 KDLKVLGRKDIKGLVQWWKDVRELFVEKETPLVVGNAADEKPKPLTQAEIEDMEDAELQTQI 359
            .||    .:.:|..:...||      :|:||      |:..|      .:|::|.|..:.|:
 Worm   298 ADL----NRQLKAELSRGKD------QKKTP------AENVP------SVEELEKAAEKFQL 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8939NP_573099.1 RlmE 8..203 CDD:223370 78/200 (39%)
DUF3381 233..366 CDD:288694 25/127 (20%)
Spb1_C 611..803 CDD:285075
R74.7NP_497843.1 RlmE 3..204 CDD:223370 77/200 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0293
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1362679at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.