DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exd and TGIF2LX

DIOPT Version :10

Sequence 1:NP_523360.1 Gene:exd / 32567 FlyBaseID:FBgn0000611 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_620410.3 Gene:TGIF2LX / 90316 HGNCID:18570 Length:241 Species:Homo sapiens


Alignment Length:136 Identity:31/136 - (22%)
Similarity:63/136 - (46%) Gaps:26/136 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 RRKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKR-------IRY 296
            ::::.|...::.:||.::.|.|....|||||.|:.|:.|..:::.|:||||.|.|       ::.
Human    51 KKRKGNLPAESVKILRDWMYKHRFKAYPSEEEKQMLSEKTNLSLLQISNWFINARRRILPDMLQQ 115

  Fly   297 KKN-------IGKAQEEANLYAAKKAAGASPYSMAGPPSGTTTPMMSPAPPQDSMGYPMGSGGYD 354
            ::|       .||.....:|.:.:.:..|.. ..:||.:..:.|:           :|:..|...
Human   116 RRNDPIIGHKTGKDAHATHLQSTEASVPAKS-GPSGPDNVQSLPL-----------WPLPKGQMS 168

  Fly   355 QQQPYD 360
            :::..|
Human   169 REKQPD 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exdNP_523360.1 PBC 42..237 CDD:461052
homeodomain 239..299 CDD:238039 20/66 (30%)
TGIF2LXNP_620410.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..58 1/6 (17%)
Homeobox_KN 69..107 CDD:428673 17/37 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 126..210 10/61 (16%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.