DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exd and TGIF2LX

DIOPT Version :9

Sequence 1:NP_001259592.1 Gene:exd / 32567 FlyBaseID:FBgn0000611 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_620410.3 Gene:TGIF2LX / 90316 HGNCID:18570 Length:241 Species:Homo sapiens


Alignment Length:136 Identity:31/136 - (22%)
Similarity:63/136 - (46%) Gaps:26/136 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 RRKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKR-------IRY 296
            ::::.|...::.:||.::.|.|....|||||.|:.|:.|..:::.|:||||.|.|       ::.
Human    51 KKRKGNLPAESVKILRDWMYKHRFKAYPSEEEKQMLSEKTNLSLLQISNWFINARRRILPDMLQQ 115

  Fly   297 KKN-------IGKAQEEANLYAAKKAAGASPYSMAGPPSGTTTPMMSPAPPQDSMGYPMGSGGYD 354
            ::|       .||.....:|.:.:.:..|.. ..:||.:..:.|:           :|:..|...
Human   116 RRNDPIIGHKTGKDAHATHLQSTEASVPAKS-GPSGPDNVQSLPL-----------WPLPKGQMS 168

  Fly   355 QQQPYD 360
            :::..|
Human   169 REKQPD 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exdNP_001259592.1 PBC 41..237 CDD:397732
homeodomain 239..299 CDD:238039 20/66 (30%)
TGIF2LXNP_620410.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..58 1/6 (17%)
Homeobox_KN 68..107 CDD:283551 17/38 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 126..210 10/61 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152663
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.