DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exd and BLH11

DIOPT Version :9

Sequence 1:NP_001259592.1 Gene:exd / 32567 FlyBaseID:FBgn0000611 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_177676.2 Gene:BLH11 / 843879 AraportID:AT1G75430 Length:290 Species:Arabidopsis thaliana


Alignment Length:293 Identity:65/293 - (22%)
Similarity:116/293 - (39%) Gaps:70/293 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 CHRMKPALF------SVLCEIKEKTVLSIRNTQEEEPPDPQLMRLDNMLIAEGVAGPEKGGGGAA 128
            |..::..|.      :|.|.::|  |:.|...:.|        ..:|:||.:...|..:.|...:
plant    10 CSSLRGTLLDSRYAKAVQCLVEE--VIDIGGREVE--------LCNNILINQLFPGRRRPGFALS 64

  Fly   129 AASAAAASQGGSLSIDGADNAIEHSDYRAKLAQIRQIYHQELEKYEQACN--------------E 179
            :...:.....|.:|:.      |:.:...|:.::..:..|..|::||.||              |
plant    65 SEIKSELCSSGFMSLP------ENHEIHIKITKLLSLLQQVEERFEQYCNQLEQVISSFEEIAGE 123

  Fly   180 FTTHVMNLLREQSRTRPITPKE---------IERMVQIIHKKFSSI------QMQL-----KQST 224
            .::.|...|..|:.||.....|         :.|...|.|:....|      |:.|     ..|:
plant   124 GSSKVYTGLALQAMTRHFGSLEEAIISQLNSVRRRFIISHQDVPKIISSGLSQLSLFDGNTTSSS 188

  Fly   225 CEAVMILRSRFLDARRKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWF 289
            .:.:.:::.....|.:..|...:.:..||..:.:.|..:|||:|..|..||.:.|::.:||||||
plant   189 LQRLGLVQGPQRHAWKPIRGLPETSVAILRAWLFQHFLHPYPNEAEKLVLASQTGLSKNQVSNWF 253

  Fly   290 GNKRIR---------YKKNIGKA-----QEEAN 308
            .|.|:|         |::..|.:     |.|||
plant   254 INARVRLWKPMIEEMYREEFGDSLDESMQREAN 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exdNP_001259592.1 PBC 41..237 CDD:397732 37/206 (18%)
homeodomain 239..299 CDD:238039 22/68 (32%)
BLH11NP_177676.2 POX 16..148 CDD:400075 29/147 (20%)
Homeobox_KN 220..259 CDD:399131 17/38 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I2603
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11850
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X78
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.