DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exd and BLH3

DIOPT Version :10

Sequence 1:NP_523360.1 Gene:exd / 32567 FlyBaseID:FBgn0000611 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_177674.1 Gene:BLH3 / 843877 AraportID:AT1G75410 Length:524 Species:Arabidopsis thaliana


Alignment Length:47 Identity:9/47 - (19%)
Similarity:18/47 - (38%) Gaps:12/47 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 ATEESKVIYRVALIISNFYIWFISTVCLAFFVLVFTSINREVSHFNQ 208
            |:|..:::.......:..:||.:.|.            ...|||:|:
plant    54 ASEAERILEEQEKAAAEKHIWIMRTQ------------EEAVSHWNE 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exdNP_523360.1 PBC 42..237 CDD:461052 9/47 (19%)
homeodomain 239..299 CDD:238039
BLH3NP_177674.1 POX 168..296 CDD:429514
Homeobox_KN 365..403 CDD:428673
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.