DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exd and KNAT7

DIOPT Version :9

Sequence 1:NP_001259592.1 Gene:exd / 32567 FlyBaseID:FBgn0000611 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_564805.1 Gene:KNAT7 / 842602 AraportID:AT1G62990 Length:291 Species:Arabidopsis thaliana


Alignment Length:325 Identity:72/325 - (22%)
Similarity:123/325 - (37%) Gaps:100/325 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GMMAPQGYGLSGQDDGQNAGSENEVRKQKDIGEI-----LQQIMS-----------ISEQSLDEA 61
            |||     |.:...||..|....:.|:.|  |||     .:|:::           |.:..:.||
plant     7 GMM-----GATVGGDGDTAVVAEQNRQLK--GEIATHPMYEQLLAAHVACLRVATPIDQLPIIEA 64

  Fly    62 Q-ARKHTL-------------NCHRMKPAL---FSVLCEIKEKTVLSIRNTQEEEPPDPQLM--- 106
            | ::.|.|             :.|.:...|   ..|||..||:....:|....|     .:|   
plant    65 QLSQSHHLLRSYASTAVGYHHDRHELDNFLAQYVMVLCSFKEQLQQHVRVHAVE-----AVMACR 124

  Fly   107 RLDNMLIAEGVAGPEKGGGGAAAASAAAASQGGSLSIDGADNAIEHSDYRAKLAQIRQIYHQELE 171
            .::|.|  ..:.|...|.|           .|.::|.|..|..::.|.                 
plant   125 EIENNL--HSLTGATLGEG-----------SGATMSEDEDDLPMDFSS----------------- 159

  Fly   172 KYEQACNEFTTHVMNLLREQSRTRPITPKEIERMVQIIHKKFSSIQMQLKQSTCEAVMILRSRFL 236
              :.:..:|:..     .:.:...|:.|.|.||  .::.:....::::|||.       .:||..
plant   160 --DNSGVDFSGG-----HDMTGFGPLLPTESER--SLMERVRQELKLELKQG-------FKSRIE 208

  Fly   237 DAR----RKRR--NFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIR 295
            |.|    ||||  ......:.:|..::..|...|||:|:.|.:|..:.|:.:.|::|||.|:|.|
plant   209 DVREEIMRKRRAGKLPGDTTTVLKNWWQQHCKWPYPTEDDKAKLVEETGLQLKQINNWFINQRKR 273

  Fly   296  295
            plant   274  273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exdNP_001259592.1 PBC 41..237 CDD:397732 42/231 (18%)
homeodomain 239..299 CDD:238039 21/63 (33%)
KNAT7NP_564805.1 KNOX1 29..67 CDD:281744 9/39 (23%)
KNOX2 84..134 CDD:281745 12/56 (21%)
Homeobox_KN 234..273 CDD:283551 14/38 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11850
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X78
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.