DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exd and KNAT6

DIOPT Version :9

Sequence 1:NP_001259592.1 Gene:exd / 32567 FlyBaseID:FBgn0000611 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_173752.3 Gene:KNAT6 / 838946 AraportID:AT1G23380 Length:329 Species:Arabidopsis thaliana


Alignment Length:399 Identity:73/399 - (18%)
Similarity:128/399 - (32%) Gaps:160/399 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 HTGG--------MMAPQGYGLSGQDDGQ----NAGSENEVRKQKDIGEILQQIMSI--SEQSLDE 60
            |:.|        ||:|:  .|....|.|    ::..||.|.......|:|...:|.  ||.:...
plant     8 HSAGDYSDKSVLMMSPE--SLMFPSDYQALLCSSAGENRVSDVFGSDELLSVAVSALSSEAASIA 70

  Fly    61 AQARKHTLN-----------CHRMKPALFSVLCEIKEKTV-------LSIRNTQEEEP------- 100
            .:.|::..|           ||...|.|.....:.::|.|       ..:...|.|..       
plant    71 PEIRRNDDNVSLTVIKAKIACHPSYPRLLQAYIDCQKKQVGAPPEIACLLEEIQRESDVYKQEVV 135

  Fly   101 ------PDPQL---------------------------------MRLDNMLIAEGVAGPEKGGGG 126
                  .||:|                                 |:|.|  :..||         
plant   136 PSSCFGADPELDEFMETYCDILVKYKSDLARPFDEATCFLNKIEMQLRN--LCTGV--------- 189

  Fly   127 AAAASAAAASQGGSLSIDGADNAIEHSDYRAKLAQIRQIYHQELEKYEQACNEFTTHVMNLLREQ 191
               .||...|:.|.:|   :|..:...|            |:..|...|.|.:            
plant   190 ---ESARGVSEDGVIS---SDEELSGGD------------HEVAEDGRQRCED------------ 224

  Fly   192 SRTRPITPKEIERMVQIIHKKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQASEILNEY 256
               |.:.    :|:::....:.|:::::..:                ::|:....::|.:.|.::
plant   225 ---RDLK----DRLLRKFGSRISTLKLEFSK----------------KKKKGKLPREARQALLDW 266

  Fly   257 FYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIRYKKNIGKAQEEANLYAAKKAAGASPY 321
            :..|...|||:|..|..||...|:...|::|||.|:|.|:.|      ...|:          |:
plant   267 WNLHYKWPYPTEGDKIALADATGLDQKQINNWFINQRKRHWK------PSENM----------PF 315

  Fly   322 SMAGPPSGT 330
            :|....||:
plant   316 AMMDDSSGS 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exdNP_001259592.1 PBC 41..237 CDD:397732 37/261 (14%)
homeodomain 239..299 CDD:238039 19/59 (32%)
KNAT6NP_173752.3 KNOX1 85..125 CDD:397730 6/39 (15%)
KNOX2 139..186 CDD:397731 6/48 (13%)
ELK 226..247 CDD:397729 2/24 (8%)
Homeobox_KN 266..305 CDD:399131 15/38 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11850
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X78
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.