DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exd and BEL10

DIOPT Version :9

Sequence 1:NP_001259592.1 Gene:exd / 32567 FlyBaseID:FBgn0000611 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001154352.1 Gene:BEL10 / 838558 AraportID:AT1G19700 Length:538 Species:Arabidopsis thaliana


Alignment Length:432 Identity:90/432 - (20%)
Similarity:154/432 - (35%) Gaps:137/432 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LSGQDD--------GQNAGSENEVRKQKDIGEILQQI-----MSISEQSLDEAQARKHTLNCHRM 73
            |.||.|        |.| |..|..|..:..|..:..:     :..::..|||..:.|..||  :|
plant   131 LLGQSDPSSGYAGNGGN-GFYNNYRYNETSGGFMSSVLRSRYLKPAQNLLDEVVSVKKELN--QM 192

  Fly    74 KPALFSVLCEIKEKTVLSIRNTQEEEPPDPQLMRLDNMLIAEGVAGPEKGGGGAAAASAAAASQG 138
            .          |:|..::..|:..:|                     .:||||..::.    |.|
plant   193 G----------KKKMKVNDFNSGSKE---------------------IEGGGGELSSD----SNG 222

  Fly   139 GSLSIDGADNAIEHSDYRAKLAQI-----------RQIYHQ--------ELEKYEQACNEFTTHV 184
            .|:.:    :.||..:.:.|..::           .|.|||        |:.....:...:|:..
plant   223 KSIEL----STIEREELQNKKNKLLTMVDEVDKRYNQYYHQMEALASSFEIVAGLGSAKPYTSVA 283

  Fly   185 MNLLREQSRTRPITPKEIERMVQIIHKKF-----SSIQMQLKQSTCEAVMILRSRFLDAR----- 239
            :|.:....|.   ....|:..:||:.:|.     .|:..|      :...|.|.|:||.|     
plant   284 LNRISRHFRA---LRDAIKEQIQIVREKLGEKGGESLDEQ------QGERIPRLRYLDQRLRQQR 339

  Fly   240 -------------RKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGN 291
                         |.:|...:.:..:|..:.:.|..:|||.|..|..||::.|::.:||:|||.|
plant   340 ALHQQLGMVRPAWRPQRGLPENSVSVLRAWLFEHFLHPYPKESEKIMLAKQTGLSKNQVANWFIN 404

  Fly   292 KRIR---------YKKNIGKA----------------QEEANLYAAKKAAGASPYSMAGPPSGTT 331
            .|:|         ||:..|..                ||:::....::....:..::|...:.||
plant   405 ARVRLWKPMIEEMYKEEFGDESELLISKSSQEPNSTNQEDSSSQQQQQQENNNNSNLAYSSADTT 469

  Fly   332 TPMMSPAPPQDSMGYPMGSGGYDQQQPYDNSMGGYDP--NLH 371
            ..:.|.....|.:   :|:.. |.||...|....||.  |.|
plant   470 NIVFSSETKPDRV---LGNDN-DPQQQQINRSSDYDTLMNYH 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exdNP_001259592.1 PBC 41..237 CDD:397732 39/224 (17%)
homeodomain 239..299 CDD:238039 23/86 (27%)
BEL10NP_001154352.1 POX 166..298 CDD:369404 29/175 (17%)
Homeobox_KN 369..408 CDD:368670 16/38 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I2603
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11850
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X78
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.060

Return to query results.
Submit another query.