DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exd and BEL1

DIOPT Version :9

Sequence 1:NP_001259592.1 Gene:exd / 32567 FlyBaseID:FBgn0000611 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_198957.1 Gene:BEL1 / 834143 AraportID:AT5G41410 Length:611 Species:Arabidopsis thaliana


Alignment Length:351 Identity:78/351 - (22%)
Similarity:121/351 - (34%) Gaps:121/351 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LAHTGGMMAPQGYGLSGQDDGQNAGSENEVRKQKDIG---------EILQQIMSISEQSLDE--- 60
            |.||..||....   |...:..|...::....|..||         |:|.:..|:..:..||   
plant   162 LQHTQMMMMMMN---SHHQNNNNNNHQHHNHHQFQIGSSKYLSPAQELLSEFCSLGVKESDEEVM 223

  Fly    61 --------------------------------AQARKHTLNCH--------RMKPALFSVLCEIK 85
                                            ..::||....|        :.|..|.|:|.|:|
plant   224 MMKHKKKQKGKQQEEWDTSHHSNNDQHDQSATTSSKKHVPPLHSLEFMELQKRKAKLLSMLEELK 288

  Fly    86 EKTVLSIRNTQEEEPPDPQLMRLDNMLIAEGVAGPEKGGGGAAAASAAAASQGGS-LSIDGADNA 149
            .:    ..:.:|:       ||:                  ||||..||...||: :....|..|
plant   289 RR----YGHYREQ-------MRV------------------AAAAFEAAVGLGGAEIYTALASRA 324

  Fly   150 IEHSDYRAKLAQIRQIYHQELEKYEQACNEFTTHVMNLLREQSR-----TRPITPKEIERMVQII 209
            :.......|...:.||             :.|:..:....|.:|     .|..||: :..:.|.:
plant   325 MSRHFRCLKDGLVGQI-------------QATSQALGEREEDNRAVSIAARGETPR-LRLLDQAL 375

  Fly   210 HKKFSSIQMQLKQSTCEAVMILRSRFLDAR--RKRRNFSKQASEILNEYFYSHLSNPYPSEEAKE 272
            .::.|..||.|               :||.  |.:|...::|...|..:.:.|..:||||:..|.
plant   376 RQQKSYRQMTL---------------VDAHPWRPQRGLPERAVTTLRAWLFEHFLHPYPSDVDKH 425

  Fly   273 ELARKCGITVSQVSNWFGNKRIRYKK 298
            .|||:.|::.|||||||.|.|:|..|
plant   426 ILARQTGLSRSQVSNWFINARVRLWK 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exdNP_001259592.1 PBC 41..237 CDD:397732 43/253 (17%)
homeodomain 239..299 CDD:238039 25/62 (40%)
BEL1NP_198957.1 POX 192..338 CDD:214728 30/174 (17%)
Homeobox_KN 409..448 CDD:283551 19/38 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11850
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X78
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.