DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exd and ATH1

DIOPT Version :9

Sequence 1:NP_001259592.1 Gene:exd / 32567 FlyBaseID:FBgn0000611 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001328067.1 Gene:ATH1 / 829435 AraportID:AT4G32980 Length:473 Species:Arabidopsis thaliana


Alignment Length:260 Identity:64/260 - (24%)
Similarity:106/260 - (40%) Gaps:58/260 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 GPEKGGGGAAAASAAAASQGGSLS--IDGADNAIE---HSDYRAKLAQIRQIYHQEL-----EKY 173
            |.|.|     |||:|..|:..:::  :||..|..|   .|.::.:..:.::.:..:|     ::|
plant   229 GTESG-----AASSAFTSRFENITEFLDGDSNNSEAGFGSTFQRRALEAKKTHLLDLLQMVDDRY 288

  Fly   174 EQACNEFTT-----HVMNLLREQSRTRPITPKEIERMVQIIHK-----------KFSSIQMQLKQ 222
            ....:|..|     |....|..|..||...     :.|..::|           ...|:..:.|.
plant   289 SHCVDEIHTVISAFHAATELDPQLHTRFAL-----QTVSFLYKNLRERICKKIISMGSVLERGKD 348

  Fly   223 STCEAVMI--------LRSRFLDARRKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCG 279
            .|.|..|.        |:.:.....|.:|...:::..:|..:.:.:..:|||.:..|..||.:.|
plant   349 KTQETSMFHQHCLLQQLKRKNHQIWRPQRGLPEKSVSVLRNWMFQNFLHPYPKDSEKHLLAIRSG 413

  Fly   280 ITVSQVSNWFGNKRIR-YKKNIGKAQEEANLYAAKKAAGASPYSMAGPPSGTT-----TPMMSPA 338
            :|.|||||||.|.|:| :|..|.:...|.|    |:....|...    |:|.|     :.|||.|
plant   414 LTRSQVSNWFINARVRLWKPMIEEMYAEMN----KRKLNNSHIQ----PNGPTLRMPKSVMMSQA 470

  Fly   339  338
            plant   471  470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exdNP_001259592.1 PBC 41..237 CDD:397732 30/151 (20%)
homeodomain 239..299 CDD:238039 22/60 (37%)
ATH1NP_001328067.1 POX 196..334 CDD:214728 24/114 (21%)
Homeobox_KN 390..429 CDD:399131 17/38 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11850
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X78
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.