DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exd and KNAT5

DIOPT Version :9

Sequence 1:NP_001259592.1 Gene:exd / 32567 FlyBaseID:FBgn0000611 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_194932.1 Gene:KNAT5 / 829335 AraportID:AT4G32040 Length:383 Species:Arabidopsis thaliana


Alignment Length:162 Identity:43/162 - (26%)
Similarity:76/162 - (46%) Gaps:31/162 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 SQGGSLSIDGADNAIEHSDYRAKLAQIRQIYHQELEKYEQACNEFTTHVMNLLREQSRTRPITPK 200
            |.|.::|.|..||.:|                .|:..::.:. :.:..:|..       .|:.|.
plant   228 SNGKTMSDDEDDNQVE----------------SEVNMFDGSL-DGSDCLMGF-------GPLVPT 268

  Fly   201 EIERMVQIIHKKFSSIQMQLKQSTCEAVMILRSRFLDARRKRR--NFSKQASEILNEYFYSHLSN 263
            |.||.:....||  .::.:|||...|.::.:|...:   ||||  ......:.:|.|::.:|...
plant   269 ERERSLMERVKK--ELKHELKQGFKEKIVDIREEIM---RKRRAGKLPGDTTSVLKEWWRTHSKW 328

  Fly   264 PYPSEEAKEELARKCGITVSQVSNWFGNKRIR 295
            |||:||.|.:|.::.|:.:.|::|||.|:|.|
plant   329 PYPTEEDKAKLVQETGLQLKQINNWFINQRKR 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exdNP_001259592.1 PBC 41..237 CDD:397732 21/100 (21%)
homeodomain 239..299 CDD:238039 22/59 (37%)
KNAT5NP_194932.1 KNOX1 117..156 CDD:397730
KNOX2 170..221 CDD:397731
Homeobox_KN 321..360 CDD:399131 15/38 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11850
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X78
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.