DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exd and KNAT1

DIOPT Version :9

Sequence 1:NP_001259592.1 Gene:exd / 32567 FlyBaseID:FBgn0000611 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_192555.1 Gene:KNAT1 / 826364 AraportID:AT4G08150 Length:398 Species:Arabidopsis thaliana


Alignment Length:305 Identity:68/305 - (22%)
Similarity:102/305 - (33%) Gaps:88/305 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 SIRNTQE------EEPPDPQLMRLDNMLIAEGVAGP------------EKGGG--------GAAA 129
            :|.||||      :...|.:.|:      |:.:|.|            :|.|.        .||.
plant   113 AIHNTQEANNNNNDNVSDVEAMK------AKIIAHPHYSTLLQAYLDCQKIGAPPDVVDRITAAR 171

  Fly   130 ASAAAASQGGSLSIDGADNAIEHSDYRAKLAQIRQIYHQELEKYEQACNEFTTHVMNLL------ 188
            ....|..|..:.|:..:....|...:......:...|.:||.:..|...||...:.:.|      
plant   172 QDFEARQQRSTPSVSASSRDPELDQFMEAYCDMLVKYREELTRPIQEAMEFIRRIESQLSMLCQS 236

  Fly   189 -------------------REQSRTR-------PITPKEIER-MVQIIHKKFSSIQMQLKQSTCE 226
                               .||....       .|.|:..:| :...:.||:|.....|||.   
plant   237 PIHILNNPDGKSDNMGSSDEEQENNSGGETELPEIDPRAEDRELKNHLLKKYSGYLSSLKQE--- 298

  Fly   227 AVMILRSRFLDARRKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGN 291
                     |..::|:....|:|.:.|..::..|...|||||..|..||...|:...|::|||.|
plant   299 ---------LSKKKKKGKLPKEARQKLLTWWELHYKWPYPSESEKVALAESTGLDQKQINNWFIN 354

  Fly   292 KRIRYKKNIGKAQ----------EEANLYAAKKAAGASPYSMAGP 326
            :|.|:.|.....|          ..|.||......|..||.: ||
plant   355 QRKRHWKPSEDMQFMVMDGLQHPHHAALYMDGHYMGDGPYRL-GP 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exdNP_001259592.1 PBC 41..237 CDD:397732 36/204 (18%)
homeodomain 239..299 CDD:238039 21/59 (36%)
KNAT1NP_192555.1 KNOX1 133..172 CDD:281744 8/44 (18%)
KNOX2 189..234 CDD:281745 8/44 (18%)
ELK 279..300 CDD:281743 6/32 (19%)
Homeobox_KN 319..358 CDD:283551 16/38 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11850
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X78
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.