DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exd and BLH7

DIOPT Version :9

Sequence 1:NP_001259592.1 Gene:exd / 32567 FlyBaseID:FBgn0000611 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_179233.1 Gene:BLH7 / 816137 AraportID:AT2G16400 Length:482 Species:Arabidopsis thaliana


Alignment Length:334 Identity:70/334 - (20%)
Similarity:109/334 - (32%) Gaps:106/334 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GLSGQDDGQNAGSENEVRKQ---------------KDIGEILQQIMSISEQSLDEAQARKHTLNC 70
            |||.|.:.....:.||...|               |...|:|.:.::: :::|.:.|.....:| 
plant    87 GLSSQIETSRGNNNNEYATQVVSGFTRTIHNSKYLKAAQELLDETVNV-KKALKQFQPEGDKIN- 149

  Fly    71 HRMKPALFSVLCEIKEKTVLSIRNTQEEEPPDPQLMRLDNMLIAEGVAGPEKGGGGAAAASAAAA 135
                        |:|||.:    .|...|.|..:...|.:.|                       
plant   150 ------------EVKEKNL----QTNTAEIPQAERQELQSKL----------------------- 175

  Fly   136 SQGGSLSI-DGADNAIEHSDYRAKLAQIRQIYHQ---ELEKYE--QACNEFTTHVMNLLREQSRT 194
              ...||| |..|.            ..:|.|||   .:..::  ..|.....:....|:..||.
plant   176 --SKLLSILDEVDR------------NYKQYYHQMQIVVSSFDVIAGCGAAKPYTALALQTISRH 226

  Fly   195 RPITPKEIERMVQIIHKKFSSIQMQLKQSTCEAVMILRSRFLDAR------------------RK 241
            .......|...:.:|.|.....|   ..|....|.|.|.|.:|.:                  |.
plant   227 FRCLRDAISGQILVIRKSLGGEQ---DGSDGRGVGISRLRNVDQQVRQQRALQRLGVMQPHTWRP 288

  Fly   242 RRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIR---------YK 297
            :|.....:..:|..:.:.|..:|||.:..|..|||:.|::..||||||.|.|:|         ||
plant   289 QRGLPDSSVLVLRAWLFEHFLHPYPKDSDKIMLARQTGLSRGQVSNWFINARVRLWKPMVEEMYK 353

  Fly   298 KNIGKAQEE 306
            :....|.:|
plant   354 EEFTDALQE 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exdNP_001259592.1 PBC 41..237 CDD:397732 37/201 (18%)
homeodomain 239..299 CDD:238039 23/86 (27%)
BLH7NP_179233.1 POX 109..236 CDD:214728 29/181 (16%)
Homeobox_KN 303..342 CDD:399131 17/38 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I2603
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11850
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X78
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.060

Return to query results.
Submit another query.