DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exd and Meis1

DIOPT Version :9

Sequence 1:NP_001259592.1 Gene:exd / 32567 FlyBaseID:FBgn0000611 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_006251591.1 Gene:Meis1 / 686117 RGDID:1585482 Length:465 Species:Rattus norvegicus


Alignment Length:149 Identity:44/149 - (29%)
Similarity:72/149 - (48%) Gaps:24/149 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 RKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIRYKKNIGKAQ 304
            :||..|.|.|:.|:..:.:.||::||||||.|::||:..|:|:.||:|||.|.|   ::.:....
  Rat   274 KKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINAR---RRIVQPMI 335

  Fly   305 EEANLYAAKKAAGASPYSMAGPP-----------SGTTTPMMSPAPPQ-----DSMGYPMGSGGY 353
            :::|    :..:..:||:..|.|           .|...|.:...|.:     ..||..||...|
  Rat   336 DQSN----RAVSQGTPYNPDGQPMGGFVMDGQQHMGIRAPGLQSMPGEYVARGGPMGVSMGQPSY 396

  Fly   354 DQ-QQPYDNSMGGYDPNLH 371
            .| |.|...:...:.|.:|
  Rat   397 TQAQMPPHPAQLRHGPPMH 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exdNP_001259592.1 PBC 41..237 CDD:397732
homeodomain 239..299 CDD:238039 26/58 (45%)
Meis1XP_006251591.1 Meis_PKNOX_N 108..192 CDD:406806
Homeobox_KN 290..329 CDD:399131 20/41 (49%)
PABP-1234 <326..449 CDD:130689 19/97 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346176
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X78
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.