DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exd and Meis1

DIOPT Version :10

Sequence 1:NP_523360.1 Gene:exd / 32567 FlyBaseID:FBgn0000611 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001423917.1 Gene:Meis1 / 686117 RGDID:1585482 Length:465 Species:Rattus norvegicus


Alignment Length:150 Identity:46/150 - (30%)
Similarity:69/150 - (46%) Gaps:26/150 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 RKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIR-YKKNIGKA 303
            :||..|.|.|:.|:..:.:.||::||||||.|::||:..|:|:.||:|||.|.|.| .:..|.::
  Rat   274 KKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQS 338

  Fly   304 QEEANLYAAKKAAGASPYSMAGPP-----------SGTTTPMMSPAPPQ-----DSMGYPMGSGG 352
            ....|        ..:||:..|.|           .|...|.:...|.:     ..||..||...
  Rat   339 NRAGN--------QGTPYNPDGQPMGGFVMDGQQHMGIRAPGLQSMPGEYVARGGPMGVSMGQPS 395

  Fly   353 YDQ-QQPYDNSMGGYDPNLH 371
            |.| |.|...:...:.|.:|
  Rat   396 YTQAQMPPHPAQLRHGPPMH 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exdNP_523360.1 PBC 42..237 CDD:461052
homeodomain 239..299 CDD:238039 27/59 (46%)
Meis1NP_001423917.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.