DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exd and MEIS2

DIOPT Version :10

Sequence 1:NP_523360.1 Gene:exd / 32567 FlyBaseID:FBgn0000611 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_733775.1 Gene:MEIS2 / 4212 HGNCID:7001 Length:477 Species:Homo sapiens


Alignment Length:179 Identity:50/179 - (27%)
Similarity:74/179 - (41%) Gaps:46/179 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 RRKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIRYKKNIGKA 303
            ::||..|.|.|:.|:..:.:.||::||||||.|::||:..|:|:.||:|||.|.|.|..:.:...
Human   277 QKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQ 341

  Fly   304 QEEANLYAAKKAAGASPYSMAGPPSGT-------------------------------------- 330
            ...|........:..:.||..|.|.|:                                      
Human   342 SNRAGFLLDPSVSQGAAYSPEGQPMGSFVLDGQQHMGIRPAGLQSMPGDYVSQGGPMGMSMAQPS 406

  Fly   331 -TTPMMSPAPPQDSMGYPMGSGGYDQQQPYDNSM---GGYDPNLHQDLS 375
             |.|.|:|.|.|...|.||.|  |....|:..:|   ||  |..|..::
Human   407 YTPPQMTPHPTQLRHGPPMHS--YLPSHPHHPAMMMHGG--PPTHPGMT 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exdNP_523360.1 PBC 42..237 CDD:461052
homeodomain 239..299 CDD:238039 27/59 (46%)
MEIS2NP_733775.1 Required for interaction with PBX1. /evidence=ECO:0000250 71..191
Meis_PKNOX_N 110..194 CDD:465140
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 193..283 2/5 (40%)
Homeobox_KN 295..333 CDD:428673 20/37 (54%)
Interaction with DNA. /evidence=ECO:0000305|PubMed:26550823, ECO:0000305|Ref.16 299..333 19/33 (58%)
Transcriptional activation domain 340..477 23/116 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.