DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exd and hth

DIOPT Version :9

Sequence 1:NP_001259592.1 Gene:exd / 32567 FlyBaseID:FBgn0000611 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_476576.1 Gene:hth / 41273 FlyBaseID:FBgn0001235 Length:487 Species:Drosophila melanogaster


Alignment Length:429 Identity:94/429 - (21%)
Similarity:151/429 - (35%) Gaps:149/429 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PQGYGLSGQDDGQNAGSEN----------EVRKQK-------DIGEILQQIMSISEQSLDEAQAR 64
            |:..|:.|   |....||:          ::|.||       ::..::.|.:.:....|.|.: :
  Fly   120 PREPGVQG---GDVCSSESFNEDIAMFSKQIRSQKPYYTADPEVDSLMVQAIQVLRFHLLELE-K 180

  Fly    65 KHTL---NCHRMKPALFSVLCEIKEKTVLSIRNTQEEEPPDPQL--------MRLDNMLIAEGVA 118
            .|.|   .|||.      :.| :|.|..:.:...:.:....|:|        ...|:....:|.:
  Fly   181 VHELCDNFCHRY------ISC-LKGKMPIDLVIDERDTTKPPELGSANGEGRSNADSTSHTDGAS 238

  Fly   119 GPE-------KGGGGAA---AASAAAASQGGSLSIDGADNAIEHSDYRAKLAQIRQIYHQELEKY 173
            .|:       ...|||.   |.|..|.|..|.||  ....|::.||...|.  :..:...||...
  Fly   239 TPDVRPPSSSLSYGGAMNDDARSPGAGSTPGPLS--QQPPALDTSDPDGKF--LSSLNPSELTYD 299

  Fly   174 EQACNEFTTHVMNLLREQSRTRPITPKEIERMVQIIHKKFSSIQMQLKQSTCEAVMILRSRFL-- 236
            .:.|.          ||.|     :|.: .|......:.:||:                  ||  
  Fly   300 GRWCR----------REWS-----SPAD-ARNADASRRLYSSV------------------FLGS 330

  Fly   237 ----------------------------DA-----RRKRRNFSKQASEILNEYFYSHLSNPYPSE 268
                                        ||     ::||..|.|.|:.||..:.:.||::|||||
  Fly   331 PDNFGTSASGDASNASIGSGEGTGEEDDDASGKKNQKKRGIFPKVATNILRAWLFQHLTHPYPSE 395

  Fly   269 EAKEELARKCGITVSQVSNWFGNKRIRYKKNIGKAQEEANLYAAKKAAGASPYSMAGPPSGTTTP 333
            :.|::||:..|:|:.||:|||.|.|   ::.:....:::|........|.|.|.           
  Fly   396 DQKKQLAQDTGLTILQVNNWFINAR---RRIVQPMIDQSNRAVYTPHPGPSGYG----------- 446

  Fly   334 MMSPAPPQDSMGYPMGSGGYDQQQPYDNSMGGYDPNLHQ 372
                   .|:|||.|.|..:...:|..      ||..||
  Fly   447 -------HDAMGYMMDSQAHMMHRPPG------DPGFHQ 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exdNP_001259592.1 PBC 41..237 CDD:397732 43/253 (17%)
homeodomain 239..299 CDD:238039 26/59 (44%)
hthNP_476576.1 Meis_PKNOX_N 127..211 CDD:406806 18/94 (19%)
Homeobox_KN 383..422 CDD:399131 19/41 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457276
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11850
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X78
43.940

Return to query results.
Submit another query.