DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exd and pknox2

DIOPT Version :9

Sequence 1:NP_001259592.1 Gene:exd / 32567 FlyBaseID:FBgn0000611 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_705940.1 Gene:pknox2 / 386959 ZFINID:ZDB-GENE-031118-112 Length:474 Species:Danio rerio


Alignment Length:383 Identity:76/383 - (19%)
Similarity:127/383 - (33%) Gaps:151/383 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 MMA-----PQGYGLSGQDDG---QNAGSENEVRKQKDIGEILQQIMSISEQSLDEAQARKHTLNC 70
            |||     |..|..|.|..|   ||:..::........|......:::..|:  :.::.|..:..
Zfish    13 MMATQSVPPPSYQESQQMTGTTQQNSKGQHVHLSAASAGGAAPVSVTLDPQA--QLESDKRAVYR 75

  Fly    71 HRMKPALFSVLCEIKEKTV------------LSIRN-----TQEEEP---PDPQLMRLDNMLIAE 115
            |.:.| |.::|.|..|:..            :.|.|     .|:.:|   .||:   |||:::  
Zfish    76 HPLFP-LLALLFEKCEQATQGSECITSASFDVDIENFVHQQEQDHKPFFSEDPE---LDNLMV-- 134

  Fly   116 GVAGPEKGGGGAAAASAAAASQGGSLSIDGADNAIEHSDYRAKLAQIRQIYHQELEKYEQACNEF 180
                                                      |..|:.:|:..||||..:.|.:|
Zfish   135 ------------------------------------------KAIQVLRIHLLELEKVNELCKDF 157

  Fly   181 TT----------HVMNLLREQ-------SRTR--------------------------------P 196
            ..          |..||||..       |:|.                                |
Zfish   158 CNRYITCLKTKMHSDNLLRNDLGGPYSPSQTSLGLQQDLLQSSSPSLTSVSSTVNSSGIVVPAGP 222

  Fly   197 ITPKEIE------------------RMV----QIIHKKF--SSIQMQLKQSTCEAVMILRSRFLD 237
            :....|.                  .||    |::.:..  .:||:|..|...:...:|......
Zfish   223 LQQNNISMTTINSQVVSGGTLYQPVAMVTSQGQVLTQGLPQGTIQIQNNQVNLDLSSLLDGDDKK 287

  Fly   238 ARRKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIR 295
            ::.||....|.|:.|:..:.:.||.:|||:|:.|.::|.:..:|:.||:|||.|.|.|
Zfish   288 SKNKRGVLPKHATNIMRSWLFQHLMHPYPTEDEKRQIAAQTNLTLLQVNNWFINARRR 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exdNP_001259592.1 PBC 41..237 CDD:397732 44/288 (15%)
homeodomain 239..299 CDD:238039 22/57 (39%)
pknox2NP_705940.1 Meis_PKNOX_N 95..178 CDD:293102 23/129 (18%)
Homeobox_KN 306..345 CDD:283551 16/38 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587165
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X78
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.