DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exd and vis

DIOPT Version :9

Sequence 1:NP_001259592.1 Gene:exd / 32567 FlyBaseID:FBgn0000611 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_788337.1 Gene:vis / 36372 FlyBaseID:FBgn0033748 Length:524 Species:Drosophila melanogaster


Alignment Length:245 Identity:58/245 - (23%)
Similarity:96/245 - (39%) Gaps:56/245 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 IRQIYHQELEKYEQACNEFTTHV-MNLLREQSRTRPITPKEIER--MVQIIHKKFSSIQMQLKQS 223
            |:.:.|:             .|| .:||..:.|.|..:...:::  :..::....|:.|...:..
  Fly    21 IKDLMHE-------------AHVHASLLNNEGRDRFHSDSSLDQDSLHAVVGNDLSTEQGANQVQ 72

  Fly   224 TCEAVMILRSRFLD----ARRKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQ 284
            ....:|:.....:|    .|::|.|..|.:.:||..:.|.|..|.|||:..|..|:::..:||.|
  Fly    73 NYHDMMVDSEHHVDINGSLRKRRGNLPKSSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQ 137

  Fly   285 VSNWFGNKRIRYKKNIGKAQEEANLY-----AAKKAAGAS-PYSMAGP----------------- 326
            |.|||.|.|.|....:.:.:....|:     ..||..||: ....||.                 
  Fly   138 VCNWFINARRRILPEMIRREGNDPLHFTISRRGKKVVGATEEVDGAGEIHEGIANVLTNFEQYVQ 202

  Fly   327 -PSGTTTPMMSPAPP-QDSMGYPMGSGGYDQQQPYDNSMGGYDPNLHQDL 374
             |:|   .|:...|. :||:.|..      ||...:|.||  ..:||..|
  Fly   203 GPNG---QMVKMEPEYEDSVIYSW------QQAIANNPMG--FQSLHSSL 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exdNP_001259592.1 PBC 41..237 CDD:397732 11/77 (14%)
homeodomain 239..299 CDD:238039 24/59 (41%)
visNP_788337.1 Homeobox_KN 109..148 CDD:283551 17/38 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457280
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.