DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exd and tgif1

DIOPT Version :9

Sequence 1:NP_001259592.1 Gene:exd / 32567 FlyBaseID:FBgn0000611 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_955861.1 Gene:tgif1 / 321756 ZFINID:ZDB-GENE-030131-475 Length:273 Species:Danio rerio


Alignment Length:150 Identity:43/150 - (28%)
Similarity:64/150 - (42%) Gaps:24/150 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 LDARRKRR-NFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIR-YKK 298
            :..:|||| |..|::.:||.::.|.|..|.||||:.|..|:::..::..||.|||.|.|.| ..:
Zfish    33 VSGKRKRRGNLPKESVQILRDWLYQHRYNAYPSEQEKALLSKQTHLSTLQVCNWFINARRRLLPE 97

  Fly   299 NIGKAQEEANLYAAKKAAGASPYSMAGPPSGTTTPMMSPAPP-------QDSMGYPMGSGGYDQQ 356
            .:.|..::.|.:.         .|..|...|......|.:|.       :|...|..||......
Zfish    98 MLRKDGKDPNQFT---------ISRRGSKGGEMLSDNSQSPKHGLLANGEDRNSYEPGSPHPTSN 153

  Fly   357 QPYDNSMGGYDPNLHQDLSP 376
            .|..|   ||.   .:.|||
Zfish   154 TPTSN---GYP---KKALSP 167

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity