DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exd and Tgif1

DIOPT Version :10

Sequence 1:NP_523360.1 Gene:exd / 32567 FlyBaseID:FBgn0000611 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001015020.1 Gene:Tgif1 / 316742 RGDID:1310517 Length:287 Species:Rattus norvegicus


Alignment Length:126 Identity:36/126 - (28%)
Similarity:56/126 - (44%) Gaps:24/126 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 RRKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIRYKKNI--- 300
            ||:|.|..|::.:||.::.|.|..|.||||:.|..|:::..::..||.|||.|.|.|...::   
  Rat    51 RRRRGNLPKESVQILRDWLYEHRYNAYPSEQEKALLSQQTHLSTLQVCNWFINARRRLLPDMLRK 115

  Fly   301 --------------GKAQEEANLYAAKKAAGASP-------YSMAGPPSGTTTPMMSPAPP 340
                          .|..|.:::.||.......|       :|....|:.|....:||.||
  Rat   116 DGKDPNQFTISRRGAKISEASSIEAAMGIKNFMPTLEESPFHSCVVGPNPTLGRPVSPKPP 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exdNP_523360.1 PBC 42..237 CDD:461052
homeodomain 239..299 CDD:238039 24/59 (41%)
Tgif1NP_001015020.1 Homeobox_KN 69..107 CDD:428673 16/37 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.