DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exd and Pknox1

DIOPT Version :9

Sequence 1:NP_001259592.1 Gene:exd / 32567 FlyBaseID:FBgn0000611 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001013092.1 Gene:Pknox1 / 294322 RGDID:1305003 Length:436 Species:Rattus norvegicus


Alignment Length:410 Identity:80/410 - (19%)
Similarity:139/410 - (33%) Gaps:123/410 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 MMAPQGYGLSGQDDGQNAGSENEVRKQKDIGEILQQIMSISE---QSLDEAQARKHTLNCHRMKP 75
            |||.|...:....|||......|::.::|..........:|.   :|.....|.|..:..|.:.|
  Rat     1 MMATQTLSIDSYQDGQQMQVVTELKTEQDPNCSDPDAEGVSPPPIESQTPMDADKQAIYRHPLFP 65

  Fly    76 --ALFSVLCEIKEKTVLSIRNTQEEEPPDPQLMRLDNMLIAEGVAGPEKGGGGAAAASAAAASQG 138
              ||....||         ::||..|........:|   |...|...||.|........      
  Rat    66 LLALLFEKCE---------QSTQGSEGTTSASFDVD---IENFVRKQEKDGKPFFCEDP------ 112

  Fly   139 GSLSIDGADNAIEHSDYRAKLAQIRQIYHQELEKYEQACNEFTTHVMNLLREQSRTR-------- 195
                        |..:...|..|:.:|:..||||..:.|.:|.:..:..|:.:..:.        
  Rat   113 ------------ETDNLMVKAIQVLRIHLLELEKVNELCKDFCSRYIACLKTKMNSETLLSGEPG 165

  Fly   196 ----PITPKEIERMV------------------------------------------QIIHKKF- 213
                |:..::|:..:                                          |::.:.. 
  Rat   166 SPYSPVQSQQIQSAITGTLSPQGIVVPASALQQGNVTMATVAGGTVYQPVTVVTPQGQVVTQALS 230

  Fly   214 --------SSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQASEILNEYFYSHLSNPYPSEEA 270
                    |.:|:||.|.    :.||......::.||....|.|:.::..:.:.|:.:|||:|:.
  Rat   231 PGTIRIQNSQLQLQLNQD----LSILHQEDGSSKNKRGVLPKHATNVMRSWLFQHIGHPYPTEDE 291

  Fly   271 KEELARKCGITVSQVSNWFGNKRIRY---------------KKNIGKAQEEANLYAAKKAAG--- 317
            |:::|.:..:|:.||:|||.|.|.|.               ||...:.:.....:....|:|   
  Rat   292 KKQIAAQTNLTLLQVNNWFINARRRILQPMLDSSCSETPKTKKKPAQNRPVQRFWPDSLASGVAQ 356

  Fly   318 ASPYSMA---GPPSGTTTPM 334
            |:|..:|   |.....|||:
  Rat   357 ATPGELAMSEGAVVTITTPV 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exdNP_001259592.1 PBC 41..237 CDD:397732 41/263 (16%)
homeodomain 239..299 CDD:238039 21/74 (28%)
Pknox1NP_001013092.1 Meis_PKNOX_N 80..165 CDD:406806 18/105 (17%)
Homeobox_KN 277..316 CDD:399131 15/38 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346197
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X78
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.