DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exd and Tgif2lx1

DIOPT Version :9

Sequence 1:NP_001259592.1 Gene:exd / 32567 FlyBaseID:FBgn0000611 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_694749.1 Gene:Tgif2lx1 / 245583 MGIID:2387796 Length:231 Species:Mus musculus


Alignment Length:180 Identity:48/180 - (26%)
Similarity:77/180 - (42%) Gaps:33/180 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 TPKEIERMVQIIHKKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRN--FSKQASEILNEYFYSH 260
            :|:|    .|...|.:||..::|:: ||      :.:|.|:|...|.  ...::.:||.::...|
Mouse     7 SPEE----TQDFMKYYSSFGIRLER-TC------KMKFHDSRELPRGNMLPLKSVKILRDWLCEH 60

  Fly   261 LSNPYPSEEAKEELARKCGITVSQVSNWFGNKR------IRYKKNIGKAQEEANLYAAKKAAGAS 319
            ..|.||:...|..|::...::..||||||.|.|      ||||        ..:|....:||.|:
Mouse    61 QFNAYPTVADKRMLSKNTDLSYLQVSNWFVNIRKHLRWEIRYK--------PYSLSHEGQAANAA 117

  Fly   320 PYSMAGPPSGTTTPMMSPAPPQDSMGYPMGSGGYDQQQPYDNSMGGYDPN 369
            ....:.|.....|.....|..|| :..|:.... :::.||..|    .||
Mouse   118 QKQHSNPSEEVKTQFNENADMQD-LPLPIRQDS-EEKVPYLES----SPN 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exdNP_001259592.1 PBC 41..237 CDD:397732 10/38 (26%)
homeodomain 239..299 CDD:238039 22/67 (33%)
Tgif2lx1NP_694749.1 Homeobox_KN 56..94 CDD:283551 13/37 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842719
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.