DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exd and Tgif2

DIOPT Version :9

Sequence 1:NP_001259592.1 Gene:exd / 32567 FlyBaseID:FBgn0000611 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_775572.1 Gene:Tgif2 / 228839 MGIID:1915299 Length:237 Species:Mus musculus


Alignment Length:126 Identity:39/126 - (30%)
Similarity:65/126 - (51%) Gaps:13/126 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 LDARRKRR-NFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIRYKKN 299
            |..:|||| |..|::.:||.::.|.|..|.||||:.|..|:.:..::|.|:.|||.|.|.|...:
Mouse    15 LTGKRKRRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSGQTNLSVLQICNWFINARRRLLPD 79

  Fly   300 -IGKAQEEANLYAAKKAAG-ASPYSMAGPPSGTTTPMMS---PAPPQ----DSMGYPMGSG 351
             :.|..::.|.:...:..| ||..::   |.|::..:::   |||..    .....|:.||
Mouse    80 MLRKDGKDPNQFTISRRGGKASDVAL---PRGSSPSLLAVSVPAPTNMLSLSVCSMPLHSG 137

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity