Sequence 1: | NP_001259592.1 | Gene: | exd / 32567 | FlyBaseID: | FBgn0000611 | Length: | 376 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001157547.1 | Gene: | Tgif1 / 21815 | MGIID: | 1194497 | Length: | 305 | Species: | Mus musculus |
Alignment Length: | 213 | Identity: | 51/213 - (23%) |
---|---|---|---|
Similarity: | 74/213 - (34%) | Gaps: | 76/213 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 239 RRKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIRYKKNI--- 300
Fly 301 --------------GKAQEEANLYAAKKAAGASP-------YSMAGPPSGTTTPMMSPAPPQD-- 342
Fly 343 ---------------------SMGYPMGSG-GYDQQQ-------------PYDNSMGGYDPN--- 369
Fly 370 ------------LHQDLS 375 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
exd | NP_001259592.1 | PBC | 41..237 | CDD:397732 | |
homeodomain | 239..299 | CDD:238039 | 24/59 (41%) | ||
Tgif1 | NP_001157547.1 | Homeobox_KN | 86..125 | CDD:283551 | 16/38 (42%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167842725 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |