DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exd and Tgif1

DIOPT Version :9

Sequence 1:NP_001259592.1 Gene:exd / 32567 FlyBaseID:FBgn0000611 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001157547.1 Gene:Tgif1 / 21815 MGIID:1194497 Length:305 Species:Mus musculus


Alignment Length:213 Identity:51/213 - (23%)
Similarity:74/213 - (34%) Gaps:76/213 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 RRKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIRYKKNI--- 300
            ||:|.|..|::.:||.::.|.|..|.||||:.|..|:::..::..||.|||.|.|.|...::   
Mouse    69 RRRRGNLPKESVQILRDWLYEHRYNAYPSEQEKALLSQQTHLSTLQVCNWFINARRRLLPDMLRK 133

  Fly   301 --------------GKAQEEANLYAAKKAAGASP-------YSMAGPPSGTTTPMMSPAPPQD-- 342
                          .|..|.:::.||.......|       :|....|:.|....:||.||..  
Mouse   134 DGKDPNQFTISRRGAKISEASSIEAAMGIKNFMPTLEESPFHSCVVGPNPTLGRPVSPKPPSPGS 198

  Fly   343 ---------------------SMGYPMGSG-GYDQQQ-------------PYDNSMGGYDPN--- 369
                                 |:..|:|.| ..|..|             |.|....|..||   
Mouse   199 ILARPSVICHTTVTALKDGPFSLCQPIGVGQSTDVPQIAPSNFTDTSLVYPEDTCKSGPSPNPQS 263

  Fly   370 ------------LHQDLS 375
                        |:||.|
Mouse   264 GLFNTPPPTPPDLNQDFS 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exdNP_001259592.1 PBC 41..237 CDD:397732
homeodomain 239..299 CDD:238039 24/59 (41%)
Tgif1NP_001157547.1 Homeobox_KN 86..125 CDD:283551 16/38 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842725
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.