DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exd and Pknox2

DIOPT Version :9

Sequence 1:NP_001259592.1 Gene:exd / 32567 FlyBaseID:FBgn0000611 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001025009.1 Gene:Pknox2 / 208076 MGIID:2445415 Length:474 Species:Mus musculus


Alignment Length:429 Identity:83/429 - (19%)
Similarity:132/429 - (30%) Gaps:183/429 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 EAQARKHTLNCHRMKPALFSVLCEIKEKTV------------LSIRN-----TQEEEP---PDPQ 104
            :.:|.|..:..|.:.| |.::|.|..|:..            :.|.|     .||.:|   .||:
Mouse    66 QLEADKRAVYRHPLFP-LLTLLFEKCEQATQGSECITSASFDVDIENFVHQQEQEHKPFFSDDPE 129

  Fly   105 LMRLDNMLIAEGVAGPEKGGGGAAAASAAAASQGGSLSIDGADNAIEHSDYRAKLAQIRQIYHQE 169
               |||:::                                            |..|:.:|:..|
Mouse   130 ---LDNLMV--------------------------------------------KAIQVLRIHLLE 147

  Fly   170 LEKYEQACNEFTT----------HVMNLLREQ-----SRTRP----------------------- 196
            |||..:.|.:|..          |..||||..     |..:|                       
Mouse   148 LEKVNELCKDFCNRYITCLKTKMHSDNLLRNDLGGPYSPNQPSINLHSQDLLQNSPNSMSGVSNN 212

  Fly   197 ----ITPKE----------------------------IERMVQIIHKKF--SSIQMQLKQSTCEA 227
                :.|..                            :....|::.:..  .:||:|..|...:.
Mouse   213 PQGIVVPASALQQGNIAMTTVNSQVVSGGALYQPVTMVTSQGQVVTQAIPQGAIQIQNTQVNLDL 277

  Fly   228 VMILRSRFLDARRKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNK 292
            ..:|.:....::.||....|.|:.|:..:.:.||.:|||:|:.|.::|.:..:|:.||:|||.|.
Mouse   278 TSLLDNEDKKSKNKRGVLPKHATNIMRSWLFQHLMHPYPTEDEKRQIAAQTNLTLLQVNNWFINA 342

  Fly   293 RIRYKKNIGKAQEEANLYAAKK----------------AAGASPYSMAGPPSGTTTPMMSPAPPQ 341
            |.|..:.:..|........|||                |||.  ....|...||.          
Mouse   343 RRRILQPMLDASNPDPAPKAKKIKSQHRPTQRFWPNSIAAGV--LQQQGGTPGTN---------- 395

  Fly   342 DSMGYPMGSGGYDQQQPY--DNS--------MGGYDPNL 370
                 |.||...|..|..  ||:        |..:|.:|
Mouse   396 -----PDGSINLDNLQSLSSDNATMAMQQAMMAAHDDSL 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exdNP_001259592.1 PBC 41..237 CDD:397732 41/268 (15%)
homeodomain 239..299 CDD:238039 22/59 (37%)
Pknox2NP_001025009.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42
gliding_GltG 5..>77 CDD:411344 2/10 (20%)
Meis_PKNOX_N 96..181 CDD:406806 24/131 (18%)
Homeobox_KN 306..345 CDD:399131 16/38 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 351..371 4/19 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 385..405 7/34 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 423..474 2/7 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842740
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X78
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.