DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exd and ceh-40

DIOPT Version :9

Sequence 1:NP_001259592.1 Gene:exd / 32567 FlyBaseID:FBgn0000611 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_510060.1 Gene:ceh-40 / 191624 WormBaseID:WBGene00000461 Length:329 Species:Caenorhabditis elegans


Alignment Length:349 Identity:121/349 - (34%)
Similarity:189/349 - (54%) Gaps:59/349 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 KDIGEILQQIMSISEQSLDEAQARKHTLNCHRMKP---------ALFSVLCEIKEKTVLSIRNTQ 96
            |.|.::|.:::.|::.::|.....|       :||         |:..||.|.|.|..||.:..:
 Worm     6 KSIMDLLSEVVKITDMTMDNEAVNK-------LKPQIKINPFYRAVQDVLVEQKSKIDLSTKMMK 63

  Fly    97 EEEPPDPQLMRLDNMLIAEGVAGPEKGGGGAAAASAAAASQGGSLSIDGADNAIEHSDYRAKLAQ 161
            :.|..:.. .|||.||.|||||||:                ...|.|..|....:: :||.:|.:
 Worm    64 DLEAQEND-ERLDTMLKAEGVAGPD----------------DSLLRIQEAAGTDQY-EYRQQLLK 110

  Fly   162 IRQIYHQELEKYEQACNEFTTHVMNLLREQSRTRPITPKEIERMVQIIHKKFSSIQMQLKQSTCE 226
            :|:....|.:.:::.|.::..:|.::|::|...||||.:..|:.:..:..||:.:...|||:.||
 Worm   111 VRRELENETKAFDKHCKKWCEYVEDVLQQQGEFRPITQQSTEKFMNKMSGKFNKVCFVLKQTACE 175

  Fly   227 AVMILRSRFLDARRKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGN 291
            .|:.|:.|:||||||||||||.::|||||||.:::::||||||.|:.||.:|.|:|:||||||||
 Worm   176 EVIQLKKRYLDARRKRRNFSKTSTEILNEYFLANINHPYPSEEVKQALAMQCNISVAQVSNWFGN 240

  Fly   292 KRIRYKKNIGKAQEEANLYAAKK-----AAGASPYSMAGPP---SGTTTP--MMSPAPPQDSMGY 346
            |||||||.:.|.::|.......:     .|..:|||:.  |   :|...|  ||.|...     :
 Worm   241 KRIRYKKTMAKNEDERRENRKPEDRPPPGAPGAPYSLV--PNAFAGMMNPYQMMLPGHQ-----F 298

  Fly   347 PMGSGGYDQQQPYDNSMGGYDPNL 370
            |:|..      |::.||  |:|.:
 Worm   299 PIGVA------PFNFSM--YNPEM 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exdNP_001259592.1 PBC 41..237 CDD:397732 56/204 (27%)
homeodomain 239..299 CDD:238039 42/59 (71%)
ceh-40NP_510060.1 PBC 5..186 CDD:281746 56/204 (27%)
homeodomain 188..249 CDD:238039 43/60 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0774
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D348471at33208
OrthoFinder 1 1.000 - - FOG0000743
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11850
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.