DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exd and Meis3

DIOPT Version :9

Sequence 1:NP_001259592.1 Gene:exd / 32567 FlyBaseID:FBgn0000611 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_036008636.1 Gene:Meis3 / 17537 MGIID:108519 Length:400 Species:Mus musculus


Alignment Length:373 Identity:81/373 - (21%)
Similarity:137/373 - (36%) Gaps:110/373 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 DEAQARKHTLNCHRMKPALFSVLCEIKEKTVLSIRNTQEEEPPDPQLMRLDNMLIAEGVAGPEKG 123
            |..:..|..:..|    .||.:|..:.||..|:..:.::.              .:.|:..|.  
Mouse    54 DSLKREKDDIYGH----PLFPLLALVFEKCELATCSPRDG--------------ASAGLGSPP-- 98

  Fly   124 GGGAAAAS-------AAAASQ--------GGSLSIDG-------ADNAIEHSDYR---AKLAQIR 163
             ||...:|       ||.|.|        ..:..:|.       .::.:.||.:.   ||:.|..
Mouse    99 -GGDVCSSDSFNEDIAAFAKQIRSERPLFSSNPELDNLNSRWSETESQLCHSSFMNQGAKMVQAI 162

  Fly   164 QI--YH-QELEKYEQACNEFTTHVMNLLR---------------------EQSRTRPITPKEIER 204
            |:  :| .||||....|:.|....:..|:                     :.:.:.|..|.:...
Mouse   163 QVLRFHLLELEKVHDLCDNFCHRYITCLKGKMPIDLVIEDRDGSCREDLEDYAASCPSLPDQNTT 227

  Fly   205 MVQIIHKKFSSIQM-----------------------QLKQSTCEAVMILRSRFLDARRKRRN-- 244
            .:: .|:...|:.:                       .|..|............||..|:|..  
Mouse   228 WIR-DHEDSGSVHLGTPGPSSGGLASQSGDNSSDQGDGLDTSVASPSSAGEDEDLDLERRRNKKR 291

  Fly   245 --FSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIRYKKNIGKAQEEA 307
              |.|.|:.|:..:.:.|||:||||||.|::||:..|:|:.||:|||.|.|   ::.:....:::
Mouse   292 GIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINAR---RRIVQPMIDQS 353

  Fly   308 NLYAAKKAAGASPYSMAGPPSG---TTTPMMSPAPPQDSMGYPMGSGG 352
            |    :...||| ::..|.|..   .|.|.::...| .|||..:...|
Mouse   354 N----RTGQGAS-FNPEGQPMAGFTETQPQVTVRTP-GSMGMNLNLEG 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exdNP_001259592.1 PBC 41..237 CDD:397732 39/249 (16%)
homeodomain 239..299 CDD:238039 27/63 (43%)
Meis3XP_036008636.1 Meis_PKNOX_N 99..205 CDD:406806 22/105 (21%)
Homeobox_KN 305..344 CDD:399131 21/41 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842716
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X78
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.