DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exd and meis2a

DIOPT Version :10

Sequence 1:NP_523360.1 Gene:exd / 32567 FlyBaseID:FBgn0000611 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_009291615.1 Gene:meis2a / 170454 ZFINID:ZDB-GENE-020122-2 Length:409 Species:Danio rerio


Alignment Length:120 Identity:41/120 - (34%)
Similarity:61/120 - (50%) Gaps:6/120 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 RRKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIRYKKNIGKA 303
            ::||..|.|.|:.|:..:.:.||::||||||.|::||:..|:|:.||:|||.|.|.|..:.:...
Zfish   285 QKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQ 349

  Fly   304 QEEANLYAAKKAAGASPYSMAGPPSGTTT------PMMSPAPPQDSMGYPMGSGG 352
            ...|........:..:.||..|.|.|:..      ..:.||.|...||..||..|
Zfish   350 SNRAGFLLDPSVSQGAAYSPEGQPMGSFVLDGQQHMGIRPAGPMSGMGMNMGMDG 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exdNP_523360.1 PBC 42..237 CDD:461052
homeodomain 239..299 CDD:238039 27/59 (46%)
meis2aXP_009291615.1 Meis_PKNOX_N 106..190 CDD:465140
Homeobox_KN 303..341 CDD:428673 20/37 (54%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.