DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exd and LOC100537845

DIOPT Version :9

Sequence 1:NP_001259592.1 Gene:exd / 32567 FlyBaseID:FBgn0000611 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_009301594.2 Gene:LOC100537845 / 100537845 -ID:- Length:218 Species:Danio rerio


Alignment Length:197 Identity:169/197 - (85%)
Similarity:184/197 - (93%) Gaps:5/197 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 VLSIRNTQEEEPPDPQLMRLDNMLIAEGVAGPEKGGGGAAAASAAAASQGGSLSIDGADNAIEHS 153
            |||||..|||:|||||:|||||||:||||:|||||||.||||:||||: |||.:    |.:||||
Zfish     8 VLSIRGVQEEDPPDPQIMRLDNMLLAEGVSGPEKGGGSAAAAAAAAAA-GGSPN----DGSIEHS 67

  Fly   154 DYRAKLAQIRQIYHQELEKYEQACNEFTTHVMNLLREQSRTRPITPKEIERMVQIIHKKFSSIQM 218
            ||||||||||||||.|||||||||:|||.|||||||||||||||:||||||||.|||:|||||||
Zfish    68 DYRAKLAQIRQIYHSELEKYEQACSEFTNHVMNLLREQSRTRPISPKEIERMVAIIHRKFSSIQM 132

  Fly   219 QLKQSTCEAVMILRSRFLDARRKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVS 283
            |||||||||||||||||||||||||||:|||:|:|||||||||||||||||||||||:|||||||
Zfish   133 QLKQSTCEAVMILRSRFLDARRKRRNFNKQATEVLNEYFYSHLSNPYPSEEAKEELAKKCGITVS 197

  Fly   284 QV 285
            ||
Zfish   198 QV 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exdNP_001259592.1 PBC 41..237 CDD:397732 123/147 (84%)
homeodomain 239..299 CDD:238039 43/47 (91%)
LOC100537845XP_009301594.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D348471at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.