DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exd and LOC100535338

DIOPT Version :9

Sequence 1:NP_001259592.1 Gene:exd / 32567 FlyBaseID:FBgn0000611 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_005168761.1 Gene:LOC100535338 / 100535338 -ID:- Length:377 Species:Danio rerio


Alignment Length:107 Identity:33/107 - (30%)
Similarity:53/107 - (49%) Gaps:3/107 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 RRKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIRYKKNIGKA 303
            ||:|.|..|::.::|.::.|.|..|.||||:.|..|:.:..::|||:.|||.|.|.|...::.:.
Zfish    50 RRRRGNLPKESVQVLRDWLYEHRFNAYPSEQEKLSLSGQTHLSVSQICNWFINARRRLLPDLLRK 114

  Fly   304 QEEANLYAAKKAAGASPYSMAGPPSGTTTP---MMSPAPPQD 342
            ..:...........:.|...|.|...|..|   ::.|||..|
Zfish   115 DGKDPTQFTMSRRTSKPDRSASPECHTPLPRPSVICPAPTLD 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exdNP_001259592.1 PBC 41..237 CDD:397732
homeodomain 239..299 CDD:238039 24/59 (41%)
LOC100535338XP_005168761.1 Homeobox_KN 67..103 CDD:283551 15/35 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587138
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.