DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF5 and SUI3

DIOPT Version :9

Sequence 1:NP_573098.1 Gene:eIF5 / 32566 FlyBaseID:FBgn0030719 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_015087.1 Gene:SUI3 / 855838 SGDID:S000006158 Length:285 Species:Saccharomyces cerevisiae


Alignment Length:150 Identity:35/150 - (23%)
Similarity:64/150 - (42%) Gaps:22/150 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RYKMPRLQAKVEGKGNGIKTVLVNMAEVARAIGRPATYPTKYFGCELGAQTLFDHKNERFVVNGS 80
            ::::|......:||    ||:..|:.::|..:.|...:..:|...|||.....|.: :|.|:.|.
Yeast   157 KFRIPPPVCLRDGK----KTIFSNIQDIAEKLHRSPEHLIQYLFAELGTSGSVDGQ-KRLVIKGK 216

  Fly    81 HDVNKLQDLLDGFIRKFVLCPECDNPETNLTVSAKNQTISQSCKACGFHGLLKVNHKVNTFIVKN 145
            ....:::::|..:|.::|.|..|.:..|.|.....|:.....||:||                 :
Yeast   217 FQSKQMENVLRRYILEYVTCKTCKSINTELKREQSNRLFFMVCKSCG-----------------S 264

  Fly   146 PPSLNPAAQGSSLTEGKRSR 165
            ..|::....|...|.|||.|
Yeast   265 TRSVSSIKTGFQATVGKRRR 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF5NP_573098.1 eIF-5_eIF-2B 10..127 CDD:280114 26/110 (24%)
W2_eIF5 254..408 CDD:211399
SUI3NP_015087.1 GCD7 124..281 CDD:224517 31/145 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1601
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.