DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF5 and Eif2s2

DIOPT Version :9

Sequence 1:NP_573098.1 Gene:eIF5 / 32566 FlyBaseID:FBgn0030719 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_080306.1 Gene:Eif2s2 / 67204 MGIID:1914454 Length:331 Species:Mus musculus


Alignment Length:138 Identity:28/138 - (20%)
Similarity:58/138 - (42%) Gaps:20/138 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KTVLVNMAEVARAIGRPATYPTKYFGCELGAQTLFDHKNERFVVNGSHDVNKLQDLLDGFIRKFV 98
            ||..||..::.:.:.|...:...:...|||.....|..|: .|:.|.....:::::|..:|:::|
Mouse   214 KTSFVNFTDICKLLHRQPKHLLAFLLAELGTSGSIDGNNQ-LVIKGRFQQKQIENVLRRYIKEYV 277

  Fly    99 LCPECDNPETNLTVSAKNQTISQSCKACGFHGLLKVNHKVNTFIVKNPPSLNPAAQGSSLTEGKR 163
            .|..|.:|:|.|....:...:  .|:.|        :.:.:...:|.         |.....|||
Mouse   278 TCHTCRSPDTILQKDTRLYFL--QCETC--------HSRCSVASIKT---------GFQAVTGKR 323

  Fly   164 SRKQKQKN 171
            ::.:.:.|
Mouse   324 AQLRAKAN 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF5NP_573098.1 eIF-5_eIF-2B 10..127 CDD:280114 21/92 (23%)
W2_eIF5 254..408 CDD:211399
Eif2s2NP_080306.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..75
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 97..120
eIF2B_5 197..306 CDD:214764 22/102 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1601
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.