DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF5 and eIF2beta

DIOPT Version :9

Sequence 1:NP_573098.1 Gene:eIF5 / 32566 FlyBaseID:FBgn0030719 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_524043.1 Gene:eIF2beta / 39433 FlyBaseID:FBgn0004926 Length:312 Species:Drosophila melanogaster


Alignment Length:94 Identity:23/94 - (24%)
Similarity:46/94 - (48%) Gaps:3/94 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KTVLVNMAEVARAIGRPATYPTKYFGCELGAQTLFDHKNERFVVNGSHDVNKLQDLLDGFIRKFV 98
            ||...|..::|:.:.|...:...:...|||.....| .|::.::.|.....:::::|..:|:::|
  Fly   195 KTSFANFMDIAKTLHRLPKHLLDFLLAELGTSGSMD-GNQQLIIKGRFQPKQIENVLRRYIKEYV 258

  Fly    99 LCPECDNPETNLTVSAKNQTISQSCKACG 127
            .|..|.:|||.|  ....:.....|::||
  Fly   259 TCHTCRSPETIL--QKDTRLFFLQCESCG 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF5NP_573098.1 eIF-5_eIF-2B 10..127 CDD:280114 21/92 (23%)
W2_eIF5 254..408 CDD:211399
eIF2betaNP_524043.1 eIF2B_5 178..287 CDD:214764 23/94 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1601
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23001
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.