DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF5 and eIF2beta

DIOPT Version :10

Sequence 1:NP_573098.1 Gene:eIF5 / 32566 FlyBaseID:FBgn0030719 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_524043.1 Gene:eIF2beta / 39433 FlyBaseID:FBgn0004926 Length:312 Species:Drosophila melanogaster


Alignment Length:94 Identity:23/94 - (24%)
Similarity:46/94 - (48%) Gaps:3/94 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KTVLVNMAEVARAIGRPATYPTKYFGCELGAQTLFDHKNERFVVNGSHDVNKLQDLLDGFIRKFV 98
            ||...|..::|:.:.|...:...:...|||.....| .|::.::.|.....:::::|..:|:::|
  Fly   195 KTSFANFMDIAKTLHRLPKHLLDFLLAELGTSGSMD-GNQQLIIKGRFQPKQIENVLRRYIKEYV 258

  Fly    99 LCPECDNPETNLTVSAKNQTISQSCKACG 127
            .|..|.:|||.|  ....:.....|::||
  Fly   259 TCHTCRSPETIL--QKDTRLFFLQCESCG 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF5NP_573098.1 eIF-5_eIF-2B 10..129 CDD:426485 23/94 (24%)
W2_eIF5 254..408 CDD:211399
eIF2betaNP_524043.1 eIF2B_5 178..287 CDD:214764 23/94 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.