DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-20 and ndhK

DIOPT Version :9

Sequence 1:NP_001285313.1 Gene:ND-20 / 32565 FlyBaseID:FBgn0030718 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_051063.1 Gene:ndhK / 844761 -ID:- Length:225 Species:Arabidopsis thaliana


Alignment Length:151 Identity:77/151 - (50%)
Similarity:110/151 - (72%) Gaps:5/151 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 TKQSSVAEWSLARLDDLLNWGRKGSIWPLTFGLACCAVEMMHIAAPRYDMDRYGVVFRASPRQAD 126
            ||.|.::    ..|:||.||.|..|:|||.:|.:||.:|...:...|:|.||||:|.|:||||||
plant    13 TKNSVIS----TTLNDLSNWSRLSSLWPLLYGTSCCFIEFASLIGSRFDFDRYGLVPRSSPRQAD 73

  Fly   127 VIIVAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHY-SYSVVRGCDRIIPVDIYVPG 190
            :|:.|||:|.||||:|.::|:|||||::||:||:|...||.:.. |||.|||.|::||||:|:||
plant    74 LILTAGTVTMKMAPSLVRLYEQMPEPKYVIAMGACTITGGMFSTDSYSTVRGVDKLIPVDVYLPG 138

  Fly   191 CPPTAEALMYGVLQLQKKVKR 211
            |||..||::..:.:|:||:.|
plant   139 CPPKPEAVIDAITKLRKKIAR 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-20NP_001285313.1 PRK06411 72..213 CDD:235797 74/141 (52%)
ndhKNP_051063.1 ndhK 1..225 CDD:214337 77/151 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1278656at2759
OrthoFinder 1 1.000 - - FOG0003606
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100846
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.