DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Slc25A46a and Slc25a46

DIOPT Version :9

Sequence 1:NP_573096.1 Gene:Slc25A46a / 32564 FlyBaseID:FBgn0030717 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001093985.1 Gene:Slc25a46 / 291709 RGDID:1305072 Length:418 Species:Rattus norvegicus


Alignment Length:312 Identity:124/312 - (39%)
Similarity:200/312 - (64%) Gaps:0/312 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 GVQWVSLVTENLLSHPFVVLRRQCQVYNASRRYHLHPFQLLPSIVHLHRRQGLTTLWKGVGSCLL 126
            |:...||.|||:|:||.:||||||||...:|.|||.||.::..:...::.||...||||:||..:
  Rat   104 GIGLASLFTENVLAHPCIVLRRQCQVNYHARHYHLTPFSVINIMYSFNKTQGPRALWKGMGSTFI 168

  Fly   127 VRGMTLAIDDFISKVTSWPKDVNSRTTLKRFGQHLLLKCISIGLVVPFYAASLVETVQSDIASEK 191
            |:|:||..:..||:.|..|::|:.:...|:.|:||||||::..:.:|||:|||:|||||:|..:.
  Rat   169 VQGVTLGAEGIISEFTPLPREVSQKWNPKQIGEHLLLKCLTYMVAMPFYSASLIETVQSEIIRDN 233

  Fly   192 PGLFDVFREGSLRLFYWSSPQKGRMLPAWALIGPSVSFGITKYLFNLVIRGVSSRIMRLRIKNSQ 256
            .|:.:..:||..|:.....|...|:||.::||.|:|..|:..|:.:.:|:.:...|::.:..:|.
  Rat   234 TGILECVKEGIGRVIGLGVPHSKRLLPLFSLIFPTVLHGVLHYIISSIIQKIVLLILKRKTCSSH 298

  Fly   257 DGQGGKYQDTTLEQQNADIYASLIAIITTEVMFFPFETILHRLQLQGTRTIIDNLDNGYDVVPIL 321
            ..:........|:....::.|:..|.:.::|:.:|.||:||||.:|||||||||.|.||:|:||.
  Rat   299 LAESTSPMQNMLDAYFPELIANFAASLCSDVILYPLETVLHRLHIQGTRTIIDNTDLGYEVLPIN 363

  Fly   322 TNYQGVVDCYQTTIVSEGVSGLYKGFGAMILQFAAHVAVIKLTKWVVNQIVE 373
            |.|:|:.||..|....|||.|.||||||:|:|:..|..::::||.:.:.:::
  Rat   364 TQYEGMRDCVNTIKQEEGVFGFYKGFGAVIIQYTLHATILQITKIIYSTLLQ 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Slc25A46aNP_573096.1 Mito_carr 277..360 CDD:278578 44/82 (54%)
Slc25a46NP_001093985.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 46..96
Solcar 1 96..187 38/82 (46%)
Solcar 2 311..416 46/105 (44%)
Mito_carr 317..402 CDD:395101 44/84 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348358
Domainoid 1 1.000 160 1.000 Domainoid score I3958
eggNOG 1 0.900 - - E1_KOG2954
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H14518
Inparanoid 1 1.050 260 1.000 Inparanoid score I3033
OMA 1 1.010 - - QHG48591
OrthoDB 1 1.010 - - D283554at33208
OrthoFinder 1 1.000 - - FOG0005765
OrthoInspector 1 1.000 - - otm45537
orthoMCL 1 0.900 - - OOG6_107935
Panther 1 1.100 - - LDO PTHR21252
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4154
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.