DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or13a and Or45b

DIOPT Version :9

Sequence 1:NP_523359.2 Gene:Or13a / 32562 FlyBaseID:FBgn0030715 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_523667.1 Gene:Or45b / 35980 FlyBaseID:FBgn0033422 Length:396 Species:Drosophila melanogaster


Alignment Length:251 Identity:56/251 - (22%)
Similarity:113/251 - (45%) Gaps:38/251 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 PYKMIF-PYDAQSSWIRYVMTYIFTSYAGICVVTTLFAEDTILGFFITYTCGQFHLLHQRIA--- 231
            |::|:| .:..:..|  :.:.|::::::|...|......|   |||..:|.....|| |.:.   
  Fly   171 PFRMLFHDFAHRMPW--FPVFYLYSTWSGQVTVYAFAGTD---GFFFGFTLYMAFLL-QALRYDI 229

  Fly   232 --GLFAGSNAELAES-IQLERLKRIVEKHNNIISFAKRLEDF-----FNPILLANLMISSVLICM 288
              .|....:..|.|| |..:||..||::||.|....|.....     |...:.|:|:|::.:|.:
  Fly   230 QDALKPIRDPSLRESKICCQRLADIVDRHNEIEKIVKEFSGIMAAPTFVHFVSASLVIATSVIDI 294

  Fly   289 VGFQIVTGKNMFIGDYVKFIIYISSALSQLYVLCENGDALIKQSTLTAQILYECQWEGSDRIEIQ 353
            :   :.:|.|:     :::::|..:..|.:::.|..|..:..:|....:..|...|...||    
  Fly   295 L---LYSGYNI-----IRYVVYTFTVSSAIFLYCYGGTEMSTESLSLGEAAYSSAWYTWDR---- 347

  Fly   354 SFTPTTKRIRNQIWFMILCSQQPVRITAFKFSTLSLQSFTAILSTSISYFTLLRSV 409
                   ..|.:::.:||.:|:|:.:.. .|...||..||:::..:.|...|.:::
  Fly   348 -------ETRRRVFLIILRAQRPITVRV-PFFAPSLPVFTSVIKFTGSIVALAKTI 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or13aNP_523359.2 7tm_6 78..399 CDD:251636 54/239 (23%)
Or45bNP_523667.1 7tm_6 68..386 CDD:251636 54/240 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465343
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.