DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or13a and Or69a

DIOPT Version :9

Sequence 1:NP_523359.2 Gene:Or13a / 32562 FlyBaseID:FBgn0030715 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_996069.1 Gene:Or69a / 2768964 FlyBaseID:FBgn0041622 Length:393 Species:Drosophila melanogaster


Alignment Length:353 Identity:74/353 - (20%)
Similarity:141/353 - (39%) Gaps:73/353 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 TFMGVLNFVRLIHLR------LNQ-RKFRQLIENFSYEIWIPNSSKNNVAAECRRRMVTFSIMTS 140
            |.:|.||..:::.|:      ||: .:..|||::.:|.|   :..:.......|.   ||...||
  Fly    87 TIVGTLNLWKMLSLKTHFENLLNEFEELFQLIKHRAYRI---HHYQEKYTRHIRN---TFIFHTS 145

  Fly   141 LLACLIIMYCVLPLV----EIFFGPAFDAQNKPFPYKM----IFPYDAQSS---WIRYVMTYIFT 194
                .::.|..||::    |.|      :.::...|::    .:|:..|.|   :...|...||:
  Fly   146 ----AVVYYNSLPILLMIREHF------SNSQQLGYRIQSNTWYPWQVQGSIPGFFAAVACQIFS 200

  Fly   195 SYAGICVVTTLFAEDTILGFFITYTCGQFHL-LHQRIAGLFAGSNAELAESIQL------ERLKR 252
            ....:||           ..||.:....|.: |.....||     |...|:|..      ::||.
  Fly   201 CQTNMCV-----------NMFIQFLINFFGIQLEIHFDGL-----ARQLETIDARNPHAKDQLKY 249

  Fly   253 IVEKHNNIISFAKRLEDFFNPILLANLMISSVLICMVGFQIVTGKNMF-IGDYVKFIIYISSALS 316
            ::..|..:::.|.|:...||...|.:|.:|.:..|.:.|.:    .|| .|..:|.::.:...::
  Fly   250 LIVYHTKLLNLADRVNRSFNFTFLISLSVSMISNCFLAFSM----TMFDFGTSLKHLLGLLLFIT 310

  Fly   317 QLYVLCENGDALIKQSTLTAQILYECQWEGSDRIEIQSFTPTTKRIRNQIWFMILCSQQPVRITA 381
            ..:.:|.:|..||..|.......:...|...|.:           .|..:..:::.:.:|.....
  Fly   311 YNFSMCRSGTHLILTSGKVLPAAFYNNWYEGDLV-----------YRRMLLILMMRATKPYMWKT 364

  Fly   382 FKFSTLSLQSFTAILSTSISYFTLLRSV 409
            :|.:.:|:.::.|.|..|...||.:||:
  Fly   365 YKLAPVSITTYMATLKFSYQMFTCVRSL 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or13aNP_523359.2 7tm_6 78..399 CDD:251636 69/341 (20%)
Or69aNP_996069.1 7tm_6 74..383 CDD:251636 69/342 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472834
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.