DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mmd and Adamdec1

DIOPT Version :9

Sequence 1:NP_001285311.1 Gene:mmd / 32561 FlyBaseID:FBgn0259110 Length:1484 Species:Drosophila melanogaster
Sequence 2:XP_017455116.1 Gene:Adamdec1 / 290338 RGDID:1309861 Length:468 Species:Rattus norvegicus


Alignment Length:475 Identity:112/475 - (23%)
Similarity:203/475 - (42%) Gaps:71/475 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 QIIYPVQLRHHEKMGISTREVSLPKPGQRPRPH---------DDSGFNRGRTKKHFHRTSLLIKA 121
            :|::|.:|...::.|:...:.......:|..|.         ::..|:..|||            
  Rat    43 KIVHPKKLPISQRRGLENNQTESYAKEERYAPEVQYQIILNGEEIIFHLKRTK------------ 95

  Fly   122 FNHKFRLDLELNSQLLSPNIQQKHYHVGGYLVDGNRHDIEHCYYHGTVKDYPGASAAFHTCNGVS 186
                         .||.|:..:..|......:.....:::.|||.|.:::..|:.|:..||:|:.
  Rat    96 -------------HLLGPDYTEISYSPRREEMTRRSQNVKPCYYEGHIQNAKGSLASISTCDGLR 147

  Fly   187 GVIHIGNETFVIHPFYGGDLSKH---PHVIFEARTKANKGCANSGNLDSWRLSRRTKHL--SAGV 246
            |.....::.:.|.|....|..:|   ||      .....|..|..:.:. ::.|:..||  |..:
  Rat   148 GYFTHRDQKYQIMPLQSTDEGEHAVIPH------NWEEPGAVNYKHSEK-QIGRKRSHLRTSRSL 205

  Fly   247 AGVVEEILQAGVGRNKRDVREATKYIETAIIVDKAMFDKRNGS-TRAEVIHDAIQVANIADLYFR 310
            ....|:.||            ..|||...:::|.:.:....|: ||....  ..:|.|:.::.::
  Rat   206 KSPNEDSLQ------------GQKYIGLFLVLDNSYYKMYKGNVTRMRSF--VFEVLNLLNVIYK 256

  Fly   311 TLNTRVSVVYIETWGKNQAVIDGSKDISKAISNFNDYTSRNLFQIERDTTQLLTGETFAGGEAGM 375
            |::.:||:|.:|.| .::..|....::....:||..:...||.|...:..|||:|..|..|..||
  Rat   257 TIDIQVSLVGMEIW-SDRDKIKVVPNLGATFTNFMRWHYSNLGQRIHNHAQLLSGAGFLHGRVGM 320

  Fly   376 AVPETVCTPRAVGISVDVNVYEPHLLAGTMAHMIGHNIGMGHDDGREECFCRDWHGCIMAQSIVG 440
            |...::||..:|.: ::........|...|:|.:||.:||.......:|   ....|:|.|.:  
  Rat   321 AAANSLCTTSSVSV-IEAKRKNNVALVALMSHELGHALGMQDVPYYTKC---PSGSCVMNQYL-- 379

  Fly   441 QENVQPYKFSECSKKDYIDALRTGHGLCLLNKPNEIE-LRRNCGNKVVEEDEECDCGTFEECALD 504
             .:..|..||..|:..:...|.:.:..|||..|:... ::..|||::::..|.||||:.|||. :
  Rat   380 -SSKFPKDFSTVSRSRFQGFLSSRNTRCLLLAPDPKNIIKPTCGNRLLDMGEGCDCGSPEECT-N 442

  Fly   505 QCCDGITCKLKSEAQCASGA 524
            .||:.:||:|||:..|...|
  Rat   443 LCCEPLTCRLKSQPDCREEA 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mmdNP_001285311.1 Pep_M12B_propep 106..213 CDD:279848 23/109 (21%)
Reprolysin 270..473 CDD:279729 52/203 (26%)
ZnMc_adamalysin_II_like 270..471 CDD:239797 51/201 (25%)
Disintegrin 488..562 CDD:278623 17/37 (46%)
ACR 566..713 CDD:214743
Adamdec1XP_017455116.1 Pep_M12B_propep 54..175 CDD:279848 25/145 (17%)
Reprolysin 217..411 CDD:279729 52/203 (26%)
ZnMc_adamalysin_II_like 217..408 CDD:239797 50/200 (25%)
Disintegrin 427..>454 CDD:299186 13/27 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339810
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3607
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D162519at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11905
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.