DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mmd and F27D9.7

DIOPT Version :9

Sequence 1:NP_001285311.1 Gene:mmd / 32561 FlyBaseID:FBgn0259110 Length:1484 Species:Drosophila melanogaster
Sequence 2:NP_509295.3 Gene:F27D9.7 / 185019 WormBaseID:WBGene00017865 Length:386 Species:Caenorhabditis elegans


Alignment Length:262 Identity:62/262 - (23%)
Similarity:105/262 - (40%) Gaps:56/262 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   270 KYIETAIIVDKAM-----FDKRNGSTRAEVIHDAIQVANIADLYFRTLNTRVSVV-YIETWGKNQ 328
            :.|...|.:|.||     :|:      |.:....|.:.:..:.||..||.|:|:: .:...|.|.
 Worm    47 RLITFLIGIDSAMTRYYNYDE------ARIRSAMIVLMHTVNQYFYPLNIRLSIIDILPVKGTNM 105

  Fly   329 AVIDGSKDISKAISNFNDYTSRNLFQIERDTTQLLTGETFAGGEAGMAVPETVCTPRAVGIS--- 390
            .:.|           |..:.......||.|.|.||....    |.|:|....:|:..::.||   
 Worm   106 GLDD-----------FISWKKEQQNLIEHDVTVLLRHNY----EGGIAYSNGICSKNSLMISGFL 155

  Fly   391 VDVNVYEPHLLAGTMAHMIGHNIGMGHDDGREECFCRDWHGCIMAQSIVGQENVQPYKFSECSKK 455
            .|..:..    |....|.:.|.||:.|.. :.:|.|         .:.:....::...|.|||.:
 Worm   156 PDATMNN----AWVFMHQLAHVIGLTHKQ-QTKCEC---------NTAINGRCLKLSGFPECSVQ 206

  Fly   456 DYIDALRTGHGLCLLNK-----PNEIELRRN----CGNKVVEEDEECDCGTFEECALDQCCDGIT 511
            :.:|.|  .:..||:.:     .|.:..::.    |||.:.|::||||||....|. :..||.:.
 Worm   207 EMVDKL--SNSSCLIQESPSFAKNTVVPKKGSLPVCGNGLQEDEEECDCGPERFCD-NILCDAVK 268

  Fly   512 CK 513
            |:
 Worm   269 CR 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mmdNP_001285311.1 Pep_M12B_propep 106..213 CDD:279848
Reprolysin 270..473 CDD:279729 47/216 (22%)
ZnMc_adamalysin_II_like 270..471 CDD:239797 47/209 (22%)
Disintegrin 488..562 CDD:278623 11/26 (42%)
ACR 566..713 CDD:214743
F27D9.7NP_509295.3 Reprolysin 56..218 CDD:366632 43/198 (22%)
Disintegrin 246..>272 CDD:385688 11/26 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3607
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D162519at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11905
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.