DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mmd and tag-275

DIOPT Version :9

Sequence 1:NP_001285311.1 Gene:mmd / 32561 FlyBaseID:FBgn0259110 Length:1484 Species:Drosophila melanogaster
Sequence 2:NP_509031.2 Gene:tag-275 / 180886 WormBaseID:WBGene00016423 Length:472 Species:Caenorhabditis elegans


Alignment Length:264 Identity:64/264 - (24%)
Similarity:106/264 - (40%) Gaps:56/264 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 TKYIETAIIVDKAMFDKRNGSTRAEVIHDAIQV-ANI------ADLYFRTLNTRVSVVYIETWGK 326
            |.:|.:.:.||        ..|.|....|.|:| .||      |:.|...|...:.||.|....:
 Worm    50 TVFIRSLVFVD--------NKTTAYYEFDMIRVKLNIMKMVDEANQYLNQLGVGLIVVGILQTNR 106

  Fly   327 NQAVIDGSKDISKAISNFNDYTSRNLFQIERDTTQLLTGETFAGGEAGMAVPETVCTPRAVGISV 391
            .        |:|  :.:|::|.:..|.::.......|....:||   |:|....:|:..:|.:| 
 Worm   107 G--------DLS--LQSFHEYRNSRLHKLPDHEFATLISYKYAG---GLAYVNGMCSSHSVSLS- 157

  Fly   392 DVNVY--EPHLLAGTMAHMIGHNIGMGHDDGRE-----ECFC--RD---WHGCIMAQSIVGQENV 444
              ..|  ||..:.....|.:.|.:|:.|....|     .|.|  :|   ..||:   .|.|.:: 
 Worm   158 --GFYPNEPRAMGSIFFHEVAHLVGVPHRAVNESIYVPNCLCTPKDSLKEDGCL---KIPGFDH- 216

  Fly   445 QPYKFSECSKKDYIDALRTGHGLCLLNKPNEIELRRNCGNKVVEEDEECDCGTFEECALDQCCDG 509
                  :|:.:.:::.:....  |:|..|...:....|||.|:|..|:||||....|: |..|..
 Worm   217 ------DCTVQQFVNTIYKNK--CILKHPIFEQSEPVCGNGVLENGEDCDCGLPGRCS-DLNCQP 272

  Fly   510 ITCK 513
            .||:
 Worm   273 HTCR 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mmdNP_001285311.1 Pep_M12B_propep 106..213 CDD:279848
Reprolysin 270..473 CDD:279729 47/221 (21%)
ZnMc_adamalysin_II_like 270..471 CDD:239797 46/219 (21%)
Disintegrin 488..562 CDD:278623 11/26 (42%)
ACR 566..713 CDD:214743
tag-275NP_509031.2 ZnMc 57..234 CDD:381785 45/212 (21%)
Disintegrin 252..>277 CDD:385688 11/26 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3607
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5934
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D162519at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11905
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.