DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mmd and LOC105946911

DIOPT Version :9

Sequence 1:NP_001285311.1 Gene:mmd / 32561 FlyBaseID:FBgn0259110 Length:1484 Species:Drosophila melanogaster
Sequence 2:XP_031754005.1 Gene:LOC105946911 / 105946911 -ID:- Length:233 Species:Xenopus tropicalis


Alignment Length:234 Identity:97/234 - (41%)
Similarity:133/234 - (56%) Gaps:28/234 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   478 LRRN-CGNKVVEEDEECDCGTFEECALDQCCDGITCKLKSEAQCASGACCDQCRLRPKDYICRDS 541
            ||.| ||||:.|..|||||||.:||. |||||..|||||..||||.|.||..|:::....:||:.
 Frog    23 LRPNVCGNKLTEVGEECDCGTVQECK-DQCCDAATCKLKPGAQCAEGECCSNCKIKAAGEVCRER 86

  Fly   542 N-NECDLPEYCDGEIGQCPSDVFKKNGSPCGLSKTGISGYCFQGYCPTLSLQCEAIWGYGGSAAD 605
            | ::|||.:.|||:...||||.|:.||:|||..:    |||:.|.|||:..||.::||......:
 Frog    87 NDDDCDLEDVCDGKSPWCPSDRFQANGAPCGKGE----GYCYNGTCPTMQRQCTSLWGDNTLVGE 147

  Fly   606 RQCYEQFNSKGSINGHCGRDANEHYIKCEPENVQCGTLQCKDGERQPVNDGIDQLYSRTIISIKG 670
            ..|:.: |.:|:..||| ::....||.|:||||.||.|.|......|...|        .:::.|
 Frog   148 DLCFNK-NMEGTDYGHC-KNVGSTYIPCKPENVMCGVLYCNSDNEYPTVPG--------RVAVTG 202

  Fly   671 QEFECKATSGQVGSNSYPEHGLVKDGTPCGDNLICLNQT 709
               ||||...       || |:|::|..|||....::::
 Frog   203 ---ECKALLA-------PE-GMVQNGIKCGDGKASVHES 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mmdNP_001285311.1 Pep_M12B_propep 106..213 CDD:279848
Reprolysin 270..473 CDD:279729
ZnMc_adamalysin_II_like 270..471 CDD:239797
Disintegrin 488..562 CDD:278623 40/74 (54%)
ACR 566..713 CDD:214743 48/144 (33%)
LOC105946911XP_031754005.1 Disintegrin 34..107 CDD:395147 39/73 (53%)
ACR 111..224 CDD:214743 48/137 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D162519at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.