DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mmd and LOC102550654

DIOPT Version :9

Sequence 1:NP_001285311.1 Gene:mmd / 32561 FlyBaseID:FBgn0259110 Length:1484 Species:Drosophila melanogaster
Sequence 2:XP_008769029.1 Gene:LOC102550654 / 102550654 RGDID:7726377 Length:193 Species:Rattus norvegicus


Alignment Length:118 Identity:36/118 - (30%)
Similarity:50/118 - (42%) Gaps:20/118 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   537 ICRDSNNECDLPEYCDGE----------IGQCPSDVFKKNGSPCGLSKTGISGYCFQGYCPTLSL 591
            :||...:||||||.||||          :|...|.:.|:......:| ...|..|..|    |.|
  Rat    14 VCRAEKDECDLPEMCDG
EVLQEGEVKEAVGYIVSQIRKQKKMKPRMS-PAFSFLCSLG----LQL 73

  Fly   592 QCEAIWGYGGSAADRQCYEQFNSKGSINGHCGRDANEHYIKCEPENVQCGTLQ 644
            ..:||.......|::.||:| |..||..|:|..:...|.    |...:|..:|
  Rat    74 MDDAIQTQETKVANKSCYKQ-NEGGSKYGYCHVENGTHM----PCKAKCALMQ 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mmdNP_001285311.1 Pep_M12B_propep 106..213 CDD:279848
Reprolysin 270..473 CDD:279729
ZnMc_adamalysin_II_like 270..471 CDD:239797
Disintegrin 488..562 CDD:278623 14/34 (41%)
ACR 566..713 CDD:214743 21/79 (27%)
LOC102550654XP_008769029.1 Disintegrin <9..30 CDD:299186 9/15 (60%)
ADAM_CR <81..>116 CDD:301627 11/39 (28%)
Peptidase_M14_like <123..>175 CDD:299699
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D162519at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.