DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rrp47 and LRP1

DIOPT Version :9

Sequence 1:NP_001285310.1 Gene:Rrp47 / 32558 FlyBaseID:FBgn0030711 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_011949.1 Gene:LRP1 / 856481 SGDID:S000001123 Length:184 Species:Saccharomyces cerevisiae


Alignment Length:144 Identity:29/144 - (20%)
Similarity:67/144 - (46%) Gaps:30/144 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LREDENMQHILKTFYSSIELLEADTEK--ALALQAERTLNTNEQIKLD--SYLVYLNSTLFFIYL 82
            :.:.|.::..:::|..:::.|:.:.||  :.:|..:..|.::|:.||:  :...|:.|:|.|..:
Yeast     1 MEDIEKIKPYVRSFSKALDELKPEIEKLTSKSLDEQLLLLSDERAKLELINRYAYVLSSLMFANM 65

  Fly    83 KLQG-EDASNHAVMHDLRRTRDLLAR----DKKINDALAAPRLDMPAAKRFIA------------ 130
            |:.| :|.|  .::.:|:|.:..:.:    |.:|..:....:.:...||..|:            
Yeast    66 KVLGVKDMS--PILGELKRVKSYMDKAKQYDNRITKSNEKSQAEQEKAKNIISNVLDGNKNQFEP 128

  Fly   131 -------AGTHTRF 137
                   .|.||:|
Yeast   129 SISRSNFQGKHTKF 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rrp47NP_001285310.1 Sas10_Utp3 32..105 CDD:281929 19/77 (25%)
LRP1NP_011949.1 Sas10_Utp3 13..89 CDD:397897 19/77 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4835
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005176
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103626
Panther 1 1.100 - - LDO PTHR15341
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.900

Return to query results.
Submit another query.